Followers

Friday, December 31, 2010 2 comments


2010  முடியுது , 2011 ஆரம்பிக்க போகிறது ..........
2010  மறக்க முடியாத வருஷம் , நான் நிறைய புதிய விஷியங்கள் செய்த வருஷம் , http://www.tamilrockzs.com/ இந்த 2010 வருஷதுலதான் தொடங்கினேன் .  மறக்க முடியாத இந்த வலைபூ http://rockzsrajesh.blogspot.com/ நான் தொடங்கி எழுத ஆரம்பிச்ச வருஷம் . அதனால எனக்கு கிடைத்த புதிய அன்பு நண்பர்கள் , என்னை தொடர்பவர்கள் அனைவருக்கும் மனமார்ந்த நன்றி நன்றி நன்றி .........
பல நல்ல விஷியங்கள் , அனுபவங்கள் என்னை கடந்து , பக்குவ படுத்தி போனது இந்த 2010 , இன்னும் புதிய விஷியங்களுக்காவும் , நல்ல அனுபவங்களுகாகவும் 2011 வருஷத்தை எதிர் நோக்குகிறேன் .
என்னை ஆதரிக்கும் அன்பு உள்ளங்களுக்கும் , நண்பர்களுக்கும் இனிய புத்தாண்டு வாழ்த்துக்கள் ..........

அன்புடன் ..........
ராக்ஸ் ...........

Monday, November 29, 2010 32 comments

        ❅கமல்ஹாசன் கோல்டன் ஹிட்ஸ் - 10 ❅        
                                              (எனக்கு பிடித்தது )


என்னை தொடர் பதிவுக்கு அழைத்த philosophy பிரபாகரன்னுக்கு நன்றிகளுடன் .  . . .

10. பேசும் படம்



                இந்த படத்தா  பத்தி நெறைய பேருக்கு தெரியாது . பேசாமலே  எடுக்கப்பட்ட பேசும் படம் . ஆமா இந்த படத்துல ஒரு வசனம் கூட கிடையாது , படம் முழுவதும் எல்லாரும் முக பாவனைகளாளையே   பட்டைய கிளப்புவாங்க . நிறைய காட்சிகள்  காமெடி கலாட்டாக்கள் & நடிப்பிளையும் பின்னி எடுப்பாங்க . ஆன என்ன புரிஞ்சுக்கதான் கொஞ்சம் அறிவு வேண்டும் . இந்த படம் 1988 ல் கன்னடத்தில் புஷ்பக் என்ற பெயரில் எடுத்த படம் பின்னர் தமிழில் டப் செய்யப்பட்டது . ஒரு வசனம் கூட பேசாத படத்தா  என்ன மொழில எடுத்த என்ன ? அப்படி டப் செய்ய என்ன இருந்ததுன்னு தெரியல . படத்தோட பெயர  மாற்றியத சொல்லுறாங்களோ  என்னவோ . என்னோட கமல் பட வரிசையில் இது ஒரு மறக்க முடியாத படம் . கண்டிப்பா எல்லாரும் பார்க்க வேண்டிய படம் ( தமிழில் தான் பார்ப்பேன்னு அடம் புடிக்காம , எந்த மொழில வேன்னும்னாலும் பாருங்க கண்டிப்பா புரியும் ஹி ஹி ஹி .. )

இயக்கம் : சங்கீதம் சீனிவாசராவ் .

எனக்கு புடிச்ச காட்சி (எ.பி.கா ) : கமல் ஸ்டார் ஹோட்டல்ல தாங்கும் போது ,  வழக்கமான ட்ரெயின் சத்தம் இல்லாம தூக்கம் வராம அவரோட  வீட்டுக்கு போய் ட்ரெயின் சத்தத ரெகார்ட் செய்துட்டு வந்து அத போட்டு கேட்டுகிட்டே   தூங்குறது , செம காமெடி .


9. மூன்றாம் பிறை



            கமலுக்கு தேசிய விருதை  வாங்கி குடுத்த படம் . பாலு மகேந்திராவின் எதார்த்தமான படம் . கமலும் , ஸ்ரீதேவியும் போட்டி போட்டுகிட்டு நடிச்சு  இருப்பாங்க. இளையராஜாவின் இதமான தாலாட்டில் இசை  .  படம் முழுவதும் தன்னோட அமைதியான நடிப்பாலும் , படத்தின் கடைசி காட்சிகளில் தன்னோட் உச்ச கட்ட நடிப்பையும் குடுத்து தேசிய விருதை தட்டிக்கிட்டு போய் இருப்பார் கமல் .

இயக்கம் : பாலு மகேந்திரா

எ.பி.கா : ஸ்ரீதேவி ஆபீஸ் பைல் ல தவறுதலா ink  கொட்டுனதுக்கு , கமல் கோபப்படுவதும் , கிளைமாக்ஸ் கட்சியும் . .



8. சலங்கை ஒலி



              சும்மாவே ஆடுவாரு கமல் . இதுல கால்ல சலங்கையா வேற  கட்டிட்டா சொல்லாவா வேண்டும்? சும்மா ருட்ருத்தாண்டவமே ஆடி இருப்பாரு .நெறைய பேருக்கு தெரியாத விஷயம் இது தமிழ் படம் இல்ல , தெலுங்கு படம் . தமிழில் டப் பண்ணினாங்க . ஆனா பாக்குறதுக்கு தமிழ் படம் மாதிரியே இருக்கும் பெரிய வித்தியாசம் ஒன்னும் தெரியாது. கமலுக்கு பாரத நாட்டியமும் முறையா தெரியும்கிறதா நிருபிச்சா படம் .

இயக்கம் : கே. விஸ்வநாத்

 எ.பி.கா : ஜெயப்ரதா நாட்டிய விழாவுக்கான அழைப்பிதழை கமல் கிட்ட குடுத்து பார்க்க சொல்லுறது , அந்த அழைப்பிதழில் கமலோட பெயரை பார்த்து ஆச்சிரியபடுவது.


7. ஆளவந்தான்



கமல் அசுர ரூபம் எடுத்து மிரட்டிய படம் . இரட்டை வேடம் கமலுக்கு . மனநிலை பாதிக்க பட்டவரா கமல் கதாபாத்திரம் மிரட்சியை ஏற்படுத்தும் . அவர் பேசும் வசனங்கள் சூப்பர் . கொடூர கொலை செய்யுற காட்சிய மென்மை ஆக்குவதற்காக அதை கிராபிக்ஸ் மூலம் கார்ட்டூன் ஆகா காட்டி வன்முறைய குறைச்சு இருப்பாரு . உண்மையில் வித்தியாசமான படம் . மீண்டும் ஒரு தேசிய விருது .

இயக்கம் : சுரேஷ் கிருஷ்ணா

எ.பி.கா : இரண்டு கமலும் ஜெயிலில் சந்திக்கும் காட்சி



6. மகா நதி


          
                         இதமாய் கிராமத்தில் ஆரம்பிக்கும் கதை , ஒரு அப்பாவி எப்படியெல்லாம் ஏமாற்றபடுகிறான், அவன் வாழ்கையில் எப்படி எல்லாம் புயல் வீசுகிறது என்பதை நெஞ்சை உலுக்க கட்சிகளை விரியும் கதை . கமலின் நடிப்பு பிரமாதம் . ஒரு தந்தையின் உச்சகட்ட வேதனையை அப்படியே நமக்கு உணர வைப்பார் கமல் . படம் முடியும் போது கண்டிப்பாக நம் கண்களில் கண்ணீர் எட்டி பார்க்கும் .

இயக்கம் : சந்தானபாரதி

எ.பி.கா : கமலின் மகளை மீட்டுவந்து பிறகு மகள் இரவில் உறக்கத்தில் உளறுவதை கேட்டு ஒரு தந்தையாக கமல் அழும் காட்சி கண்டிப்பாக மனசை ஏதோ செய்யும் .



5 .இந்தியன்



                     பிரமாண்டத்தின் பிரமாண்டம் , இந்த படத்தோட trailer  காகவே நான் பல நாள் காத்து இருந்தேன் . காரணம் கமலே ஒரு பிரமாண்டம் இதில் ஷங்கர் , A . R  ரஹ்மான் எல்லாம் சேர்ந்தா சொல்லவா வேண்டும்? இதிலும் கமலுக்கு இரட்டை வேடம் , அந்த வயசான கமல் கதாபாத்திரத பற்றி சொல்லியே ஆகா வேண்டும் . முதல் முதலா  அந்த வயசான கதாபாத்திரத்துக்கு மேக் அப்க்கு வெளிநாட்டு மேக் அப் மேன் வச்சு போட்டு கமல் வீட்டுக்கு போனப்போ கமல் குடுபத்தாளையே கண்டு புடிக்க முடியலன்னு ஒரு சுவாரசியமான செய்தி உண்டு .ஒவ்வொரு நாளும் மேக் அப்புகாகவே பல மணி நேரம் செலவிட்டார்கள் .இந்த படத்தா பற்றி சொல்லனும்ன நெறைய சொல்லலாம் . பாடல்கள் , கிராபிக்ஸ் , நடிப்புன்னு  கமல் ரவுண்டு கட்டி அடிச்சா மெகா ஹிட் திரைபடம் .

இயக்கம் : ஷங்கர்

எ.பி.கா : வயசான கமல் வரும் எல்லா காட்சிகளும் எனக்கு பிடிக்கும் . இளமையான கமல் அடிக்கும் கூத்துக்களும் சுவாரசியம் .


4. குணா



                    நமக்கு புரியாத ஒரு உணர்வை நமக்கு உணர்த்தி இருப்பார் கமல் . இதுலயும் கொஞ்சம் மனநிலை பாதிக்கபட்ட கதாபாத்திரம் , பரிசுத்தமான அன்புக்கு எங்கும் கதாபாத்திரம் . இளையராஜாவும் , கேமரா மேனும் நம்மை  கட்டி போடுவாங்க படம் பார்க்கும் போது . அந்த கண்மணி அன்போட காதலன் பாடல் இன்றைக்கு கேட்டாலும் சலிக்காத வித்தியாசமான பாடல் . அந்த குகை கட்சிகள் எடுப்பதிற்காக இதுவரை யாரும் போகாத மலை பகுதிக்கு எல்லாம் போய் எடுத்ததாக கூற படிக்கிறது . கமல் மீண்டும் தன்னை நிருபித்த நெஞ்சை தொடும் ஒரு படம் .

இயக்கம் :  சந்தான பாரதி

எ.பி.கா : கமல் அவரோட தேவதை அபிராமியோடு இருக்கும் அதனை கட்சிகளும் மனதை கொள்ளை கொள்ளும் கவிதை .



3 .அபூர்வ சகோதரர்கள்



                       நான் சின்ன பையன இருக்கும் போது இத்தனை fantasy  யா ஒரு படம் பார்த்தது இல்லை . இந்த படத்தில் வரும் அத்தனை கட்சிகளும் எனக்கு அத்துபடி .என்னை பலமுறை பார்க்க வைத்த படம் . கமல் இதில் மூன்று விதியாசமான வேல்டம் .இன்னம் ஆச்சிரியமாய் இருக்கும் விஷயம்" கமல் எப்படி சார் குள்ளமானார் ? " அப்போது அதனை கிராபிக்ஸ் கூட இல்லாத கால கட்டம் . மிகவும் திறமையாக எல்லா காட்சிகளும் எடுத்து இருப்பார்கள் . பாடல்கள் செம ஹிட் , அண்ணாத்த ஆடுறார் ஒத்திக்கோ பாடல் இன்னைக்கு கேட்டாலும் என்னை ஆட வைக்கும் . மனோரம்மாவும் . ஜனகராஜ் , கமல் கூட்டணி அடிக்கும் லூட்டி இன்னைக்கு பார்த்தாலும் சிரிக்க வைக்கும் . காதல் , காமெடி , சோகம் , சண்டைன்னு சும்மா கலந்து கட்டி அடிச்சு இருப்பாரு கமல் . இளையராஜவ சொல்லவே வேண்டாம் அவரும் கைகோர்த்து நம்பள ஒரு வழி ஆக்கிய படம். 

ஆச்சரியம் : சுவாரசியமான ஆச்சரியம் . இந்த விஷயம் நெறைய பேருக்கு தெரியாது . கமலின் குள்ளமான கதாபாத்திரத்துக்கு அவர் எத்தனை மெனக்கெட்டு இருப்பாரு என்று . கமல் என்னதான் காலை குள்ளம் ஆக்கினல்லும் உடம்பையும் குள்ளமாக காட்டுவதற்கு குள்ளமான கை வைச்ச கோட் , உடைகளை அணிந்து இருப்பார் பார்பதற்கு குள்ளம தெரியும் . குள்ளம இருபவர்களுக்கு கண்டிப்பா பல்லும் சின்னதா இருக்கும் அதனால் , குள்ள கமல் அவரோட பல்லையும் சின்னதா ஆக்கி இருப்பார் சிரிக்கும் போது கவனித்து பாருங்கள் தெரியும் , இது கமலின் மேக் அப் ரகசிகளில் இருந்து .அதுதான் கமல் . இத்தனை உழைப்பா ? கண்டிப்பாக ஆச்சரியம் .

இயக்கம் : சங்கீதம் சீனிவாசராவ்

எ.பி.கா : வேற என்னத்த சொல்ல? குள்ள கமல் ரூபிணிய கல்யாணம் பண்ணிக்க போறோம்ன்னு நினைச்சு ரிஜிஸ்டர்  ஆபீஸ்க்கு போய் ஏமாறும் அந்த காட்சி எத்தனை முறை பார்த்தாலும் கண்கள் குளமாக்கும்


2. அன்பே சிவம்



                     இந்த படத்த பற்றி என்னனு சொல்ல ? ஒவ்வொரு காட்சியும் அத்தனை அர்த்தங்கள் கொண்டது . மாதவன் வாங்கும் ஒவ்வொரு பதில் அடியும் ஒவ்வொரு பாடம் . மனுஷன் இப்படி எப்படி எல்லாம் யோசிக்க முடியுமா? . மனிதனுக்குள் இத்தனை உண்டா ? கமல் வாழ்ந்து இருப்பார். விபத்துக்கு முன் அந்த வீரமான நடிப்பும் , விபத்துக்கு பின் அந்த சோகமான நடிப்பும் , வசனங்களில் அந்தனை கூர்மை . நெறைய பேருக்கு இது ஒரு நல்ல படம்ன்னு புரியரதுக்கே  ரொம்ப நாள் ஆச்சு . என்னை யோசிக்க வைத்த படம் . கமல் படம்


ஆச்சரியம் : அந்த விபத்து நடந்த அப்புறம் கமல் உடம்பில் நெறைய பாதிப்பு . ஒரு கால் குட்டை ஆகிடும் .கண்களின் திறனும் குறைந்து போவதால் கண் கண்ணாடி அணிந்து இருப்பார் . அது மிகவும் அதிக power உள்ள சோடா புட்டி கண்ணாடி . சாதரணம கொஞ்சம் பவர் இருக்க கண்ணாடிய போட்டாலே நமக்கு எல்லாம் தலைவலிக்கும் , சரியா பார்க்க முடியாது . ஆனா கமல் எப்படி அவ்வுளவு பவர் உள்ள கண்ணாடிய போட்டுகிறு அந்தனை கட்சிகள் நடிச்சு இருப்பாரு ?
விடை : எத்தனை பவர் உள்ள கண்ணாடிய போட்டு இருக்காரோ , அத்தனை பவர் குறைவா இருக்க காண்டக்ட் லென்ஸ் அணிந்து நடிச்சு இருப்பார் . அதாவது உதரணத்துக்கு அந்த கண்ணாடி பவர் +4  என்றால் , -4  பவர் உள்ள காண்டக்ட் லென்ஸ் போட்டுகிட்ட அப்போ பவர்  சமம் ஆகும் , அதனால கண்களால் சாதரணம பார்ப்பது போல் பார்க்கலாம் . இது கமல் செய்த புத்திசாலித்தனம் . HATS  OFF  கமல்ஜி .

இயக்கம் : சுந்தர் . சி

எ.பி.கா : கமலின் கூர்மையான வாசனைகள் பேசும் அத்தனை காட்சிகளும் , கிளைமாக்ஸ் காட்சியும்



1. நாயகன்



              கமல், மணிரத்னம் , இளையராஜா ,  P .C  ஸ்ரீராம்  இதுக்கு மேல என்ன சொல்ல? பொதுவா மணிரத்னத்துக்கு வசனங்களில் நம்பிக்கை இல்லாதவர் , தொனதொனணு வசனம் பேசுவதால் காட்சியை விவரிக்க முடியாது , காட்சி அமைப்பு , எதார்த்தமான நடிப்பினாளையே கதையை சொல்ல முடியும் , மக்கள் புரிந்து கொள்வார்கள் என்று சொல்பவர் மணி . இது போதாத ? கமலுக்கு? அமைதியான நடிப்பு , ஆவேசம் , உடல் மொழி , கண்களால் ஆயிரம் அர்த்தங்கள் அப்படின்னு சும்மா புகுந்து விளையாடி இருப்பாரு கமல் . கூட கச்சேரிக்கு இளையராஜா வேற . படம் ஆரம்பிச்சு முடியுரவரைக்கு இந்த ஜாம்பாவான்கள் நம்மை அந்த கதைக்குளையே கட்டி போட்டு இருப்பார்கள் . சின்ன வயசில் ஒரு நல்ல படம் வந்து இருக்கு அதை கண்டிப்பா நாம்ப பார்க்கணும் ன்னு சொல்லி என்னையும் , அம்மாவையும் தியேட்டர்க்கு கூட்டிட்டு போய் காட்டினர் என்ன அப்பா , பசுமையான நினைவுகள் . ஆஸ்கார் தன்னை அலங்கரித்து கொள்ள தவறிய படம். ஆஸ்கார்க்கு நேர்ந்த அவமானம் அது , தேசிய விருது வந்து தன்னை பெருமை படுத்தி கொண்டது இந்த படத்துக்கு.

இயக்கம் : மணிரத்னம்

எ.பி.கா : மொத்த படமுமே என்னை கொள்ளைகொண்டதுதான் குறிப்பிட்டு ஒரு காட்சிய சொல்ல முடியாது .


விருதுகள் :
வருட வருடம் விருது தேர்வு செய்யும் முன்பு , " சார் 1st கமலுக்கு ஒரு விருது எடுத்து வைங்க "அப்படின்னு தேர்வு குழு முடிவு செய்யுற அளவுக்கு கமல் விருது வாங்கி இருக்காரு . எல்லா விருதையும் பட்டியல் இட்டால் இந்த பாத்து பத்தாது அதனால் தேசிய விருதுகள் மட்டும் .
நன்றி  விக்கிபீடியா  :

1960 Kalathur Kannamma Selvam Tamil Winner, National Film Award for Best Child Artist
1975 Apoorva Raagangal Prasanna Tamil Winner, Filmfare Best Tamil Actor Award
1982 Moondram Pirai Srinivasan Tamil Winner, National Film Award for Best Actor
1983 Sagara Sangamam Balakrishna Telugu Winner, Filmfare Best Telugu Actor Award
Winner, Nandi Award for Best Actor
1987 Nayagan Velu Tamil Winner, National Film Award for Best Actor
1988 Pushpak Pushpak Silent Winner, Filmfare Best Kannada Actor Award
1989 Apoorva Sagodharargal Sedhupathy,
Raja,
Appu
Tamil Winner, Filmfare Best Tamil Film Award
Also producer and screenwriter
Portrayed three roles; one was a dwarf
1992 (     ) Magan Shakthivelu Tamil Winner, Filmfare Best Tamil Actor Award
Also producer and screenwriter
1996 Indian Senapathy Bose,
Chandra Bose
Tamil Winner, National Film Award for Best Actor
Winner, Filmfare Best Tamil Actor Award
Portrayed a dual role
2000 Hey Ram Saket Ram Tamil
Hindi
Winner, Filmfare Best Tamil Actor Award
Also producer, director, and screenwriter
2008 Dasavathaaram Ten different roles Tamil Winner, Tamil Nadu State Film Award for Best Actor
Portrayed 10 different roles
Also screenwriter



                    கமல் அவதாரங்கள் :                               


  





டிஸ்கி :
இதுவரை நீங்கள் பார்த்திறதா கமல்பாடல்  

                                            என்ஜாய்                                                                                                                       Dont  Miss It  . . .






இதன் தொடர் பதிவு எழுத விசா வை அன்புடன் அழைக்கிறேன் ,
http://writervisa.blogspot.com/


Its KAMAL HASSAN
அன்புடன்,
ராக்ஸ் ..........


For fun chat, blog, forum, videos, games, live FM  kindly visit our website:  www.tamilrockzs.com






 

Saturday, November 20, 2010 18 comments




Note : 
சாதி = எய்ட்ஸ்  (part-1) படிக்காதவர்கள் , முதலில் அதை படித்துவிட்டு     ( part -2 ) தொடரவும் . சாதி = எய்ட்ஸ்  (part-1) படிக்க இங்கே சொடுக்கவும் (click on)
http://rockzsrajesh.blogspot.com/2010/11/1.html

        சரி இப்போ எதுக்கு  இவ்வளவு கோவம்? இப்போ இந்த 21 வது நூற்றாண்டுல அப்படி என்ன சாதி கலவரம் நடக்குது ? எதுக்கு இந்த பதிவு ன்னு கேக்குறிங்களா?
அவங்களுக்க்காகதான்  இந்த தலைப்பும் , அந்த தலைப்புக்கான விளக்கமும். 

காட்சி - 1
          ஒரு மெத்த படித்த குடும்பம் , பெற்றோர்கள் நல்ல உயர்ந்த பணியில் இருப்பவர்கள் . அவர்களுக்கு ஒரு மகன் , ஒரு மகள் .  மகனுக்கு ஒரு உயிர் நண்பன் . சிறு வயதில் இருந்தே அவர்கள் வீட்டுக்கு வந்து போகிறவன் .நண்பனுக்கு எதிர் பாராத விதமாக ஒரு விபத்து ஏற்பட்டு,  சிகிச்சை அளிக்கும் போது தவறுதலாக HIV எய்ட்ஸ் பரவி விடுகிறது . இதை அறியும் அந்த குடும்பத்தினர் , நன்கு படித்தவராகைனாலும் , மருத்துவத்தில் விழிப்புணர்வு கொண்டவராகைனாலும் , HIV எய்ட்ஸ் பற்றி தெரிந்ததனால் . அந்த மகனின் நண்பனிடத்தில் எந்த வித ஒதுக்குதல் இல்லாமல் சகஜமாகவும் , அக்கறையுடனும்  பழகுகிறார்கள்.  மகனின் நண்பன் வழக்கம் போல் வீட்டுக்கு வருகிறான் , அவர்களோட பழகுகிறான் , தொடுகிறான் , விளையாடுகிறான் , ஒன்றாக உட்கார்ந்து  உணவு கொள்கிறார்கள் , ஒரே தட்டில் உணவு உட்கொள்கிறார்கள் . இது போல் வாழ் நாள் முழுவதும் இருக்க அந்த குடும்பத்தினருக்கு எந்த வித ஆட்சேபனையும் இல்லை . ஏனென்றால் இதன் மூலம் HIV எய்ட்ஸ் பரவாது . அது அவர்களுக்கு தெரியும் . ஆனால் அந்த நண்பன் அந்த வீட்டு பெண்ணின் மேல் காதல் கொள்கிறான் , அந்த பெண்ணை திருமணம் செய்து கொள்ள விரும்புகிறான். அந்த குடும்பத்திடம் போய் , நான் உங்க பெண்ணை திருமணம் செய்து கொள்ள விரும்புகிறேன் அப்படின்னு பொண்ணு கேட்டா , அங்க என்ன நடக்கும்? பெரிய பூகம்பமே வெடிக்கும் . " ஏன்டா நாய்யே போன போகுதுன்னு மனிதாபிமானத்தோட இரக்க பட்டு வீட்டுக்குள்ள சேர்த்தா , சாப்பாடு போட்ட , நீ உண்ட வீட்டுக்கே பாதகம் நினைக்கிறியா ? நன்றிகெட்ட நாயே " . அப்படின்பாங்க .  இல்ல தெரியாமதான் கேக்குறேன் எந்த பெற்றோர்கள் சார் ஒத்துக்குவாங்க? ஒரு HIV எய்ட்ஸ் உள்ள ஒருவனுக்கு தங்களோட பெண்ணை கல்யாணம் பண்ணி குடுக்க?

அந்த மாதிரிதான் சார் இப்போ சாதிய நினைக்குறாங்க . என்ன ஒரு வேதனையான விஷயம் .

இப்போ இங்க எய்ட்ஸ் இருக்க இடத்தில எல்லாம் , வேற சாதியோ இல்ல , கீழ் சாதியோ போட்டுகங்க .

காட்சி - 2
                 ஒரு  குடும்பம் . நல்ல பெற்றோர்கள் .அவர்களுக்கு ஒரு மகன் , ஒரு மகள் .  மகனுக்கு ஒரு உயிர் நண்பன் . சிறு வயதில் இருந்தே அவர்கள் வீட்டுக்கு வந்து போகிறவன் . ஆனால்  நண்பன் அவர்கள் சாதி கிடையாது . வேறு சாதியோ , இல்லை கீழ் சாதியையோ சேர்ந்தவன் . இதை அறியும் அந்த குடும்பத்தினர் , அந்த மகனின் நண்பனிடத்தில் எந்த வித ஒதுக்குதல் இல்லாமல் சகஜமாகவும் , அக்கறையுடனும்  பழகுகிறார்கள்.  மகனின் நண்பன் வழக்கம் போல் வீட்டுக்கு வருகிறான் , அவர்களோட பழகுகிறான் , தொடுகிறான் , விளையாடுகிறான் , ஒன்றாக உட்கார்ந்து  உணவு கொள்கிறார்கள் , ஒரே தட்டில் உணவு உட்கொள்கிறார்கள் . இது போல் வாழ் நாள் முழுவதும் இருக்க அந்த குடும்பத்தினருக்கு எந்த வித ஆட்சேபனையும் இல்லை . ஏனென்றால் இதன் மூலம் HIV எய்ட்ஸ்  சாதி பரவாது . அது அவர்களுக்கு தெரியும்  ஆனால் அந்த நண்பன் அந்த வீட்டு பெண்ணின் மேல் காதல் கொள்கிறான் , அந்த பெண்ணை திருமணம் செய்து கொள்ள விரும்புகிறான். அந்த குடும்பத்திடம் போய் , நான் உங்க பெண்ணை திருமணம் செய்து கொள்ள விரும்புகிறேன் அப்படின்னு பொண்ணு கேட்டா , அங்க என்ன நடக்கும்? பெரிய பூகம்பமே வெடிக்கும் . " ஏன்டா நாய்யே போன போகுதுன்னு மனிதாபிமானத்தோட இரக்க பட்டு வீட்டுக்குள்ள சேர்த்தா , சாப்பாடு போட்டா , நீ உண்ட வீட்டுக்கே பாதகம் நினைக்கிறியா ? நன்றிகெட்ட நாயே " . அப்படின்னு அன்போட கொஞ்சுவாங்க . இல்லை நல்ல படித்த அப்பாவாக இருந்தால் " இல்ல தம்பி எங்க வீடு பெண்ணை வேற இடத்துல முடிவு பண்ணிட்டோம்  . உங்களுக்கு கல்யாணம் பண்ணி குடுக்க எங்களுக்கு விருப்பம் இல்லை" அப்படின்னு ரீஜெண்ட சொல்லிடுவாங்க .

                இதுதான் சார்  இன்றைய நிலைமை.  நீ என்ன சாதியா வேண்டுமானாலும் இருந்துக்கோ , வேற சாதியோ , கீழ் சாதியோ, மேல் சாதியோ . பிரச்னை இல்லை . வீட்டுக்கு வா போ  , சாப்பிடு , தங்கு , வீட்டு  விஷசங்களில் கலந்துக்கோ . ஒரு கவலையும் இல்லை . வீட்டுல கல்யாணம்ன்ன பாசத்தோட கூப்பிடுவாங்க , " தம்பி இது நம்ப வீட்டு கல்யாணம் , மத்தவங்க மாதிரி கல்யாணத்தன்னைக்கு வந்தோமா , gift  குடுத்தோம , சாப்பிட்டோம போனமனு இருந்த உன்ன கொன்னுடுவேன் , கல்யாணத்துக்கு ஒரு வாரத்துக்கு முன்னாலையே வந்து இருந்து நீதான் கல்யாண வேலையெல்லாம் பாக்கணும் . அப்படின்பாங்க . அதே மாதிரி நம்ப  வீட்டு கல்யாணத்துக்கு ஒரு வாரத்துக்கு முன்னாலையே வந்து இருந்து எல்ல வேலையும் இழுத்து போட்டு செஞ்சுட்டு போவாங்க , பாசக்கார பயலுங்க . ஆனா அதே நீ பொண்ண கட்டிகுடு , பையன கல்யாணம் பண்ணிகுடுனு மட்டும் அந்த குடும்பத்துல கேட்டுட அவ்வுளவுதான் . ஒரு ருத்ரதாண்டவமே நடக்கும் .
                  வசூல் ராஜா MBBS  ல கமல்ஹாசன் சொல்லுற மாதிரி , என்னோட பொருள் எல்லாம் நீ use  பண்ணிக்கலாம் , உன்னோடத எல்லாம் நான் use  பண்ணிக்குவேன் ஆனா " உன்னோட ஜட்டிய நான் தொட மாட்டேன் , அதே மாதிரி என்னோட ஜட்டிய நீ தொட கூடாது " ஜென்டில்மேன் அக்ரீமென்ட் . என்ன கொடுமை இதெல்லாம்?  அப்போ சாதி என்ன ஜட்டி மாதிரியா? . சாதியே இல்லைங்கிறேன் அப்புறம் என்ன? 
            இப்போ புரியுதா சார் , இந்த 21 ஆம் நூற்றாண்டுல சாதி ஒரு உயிர் கொல்லி நோய் போலதான் இருக்கு . வெளிய தெரியாது ஆன உள்ளே தீயா இன்னும் எரிஞ்சுக்கிட்டு தான் இருக்கு .  

இதுதான் சார் இந்த போஸ்ட் தலைப்புக்கு காரணம் : சாதி = எய்ட்ஸ்  

                   இன்றைய  நிலைமைல பார்த்த உடனே யாரும் நீ என்ன சாதின்னு கேக்குறது இல்ல . ஆனா கொஞ்சம் பழகினதுக்கு  அப்புறம் , பேச்சு வாக்கில் , லைட் டா " அப்புறம் நீங்கே எல்லாம் என்னவங்க?"  அப்படின்னு ,  அதுக்கு நாம்ப ஒரு மாதிரி பார்த்த , " இல்ல எங்க இதுல எல்லாம் இப்படி பண்ணுவாங்க நாங்க இந்த ஆளுங்க , அதான் உங்க இதுல எப்படி பண்ணுவிங்கன்னு தெரிஞ்சுகத்தானன்னு " பொடி வைப்பார்கள்  ஆனா அது பொடி இல்ல வெடி . ஆதனால  எதாவது ஒரு தருணத்தில் கொஞ்சம் பேர் கேக்கத்தான் செய்கிறோர்கள் .அதுவும் இந்த தலை முறையினரே  கேக்குறாங்க சார் . அதுதான் ஆச்சிரியமாவும்  வெக்கமாவும் இருக்கு .
வெளிநாட்டு பிச்சைக்காரர் ......

                 பிச்சைகாரனுக்கு லட்டரில 1 கோடி பரிசு விழுந்தாலும் வெளிநாட்டுல போய் தங்க தட்டுல பிச்சை எடுக்கன்னும்ன்னு ஆசைப்படுவானம் . அந்த மாதிரி, என்னதான் டெக்னாலஜி வளர்ந்து கம்ப்யூட்டர்  , இன்டர்நெட் , ஈமெயில் , blogspot  எல்லாம் வந்தாலும் . கம்ப்யூட்டர்ல ஜாதகம் பார்க்குற மாதிரி .  இங்க ப்ளாக் ளையும் வந்து தன்னோட சாதி பற்றி புகழ்தோ  , இல்ல மற்ற சாதி பற்றி இக்ழல்ந்தோ ப்ளாக் , பின்னோட்டம் எழுதுறவங்கள , சண்டை போடுறவங்க  பார்க்கும் போது மனசு ரொம்ப வேதனைய இருக்கு . என்ன சாதி சண்டைய நியூ டெக்னாலஜில போடுறிங்களா? இதுக்குதான் டெக்னாலஜி  வளர்ச்சியா?  வெக்கமா இல்ல ? நீங்க எல்லாம் படிச்சவங்க ன்னு சொல்லிக்க ? என்னத்தையா அப்படி படிச்சிங்க? 

                 சரி சொல்லுங்க சார் , சாதி பெருசா ? மதம் பெருசா?

                                     சாதிதான் சார் பெருசு .

என்னையா இது? மதம்தான் எத்தனையோ சாதிகளை உள்ளடக்கியது , எத்தனை பெரிய அமைப்பு அது ,அத விட்டுட்டு சாதிதான் பெருசுன்னு சொல்லுறேன்னு கேக்குறிங்களா? சரி நான் உங்ககிட்ட ஒண்ணு கேக்குறேன் , இப்போ நினைச்ச உங்களால மதம் மாற முடியும். அதை மாறிய மதம் ஏற்றுக்கொள்ளும் , மக்கள் ஏற்றுகொள்வார்கள், அரசாங்கமும் ஏற்றுகொள்ளும் . மதம் மாறி, மாறிய மதத்துக்கான சான்றிதழும் நீங்கள் வாங்கலாம் அரசாங்கத்திடம் இருந்து . முழுவதும் அங்கீகரிக்க படும் .
                      ஆனால் செத்தா கூட சாதி மாற முடியாது அப்பு . எந்த சாதிக்காரனும் ஒத்துக்கமாட்டான், சாதி மாறினேன்னு சொன்னே அரசாங்கம் ஜெயில்ல புடிச்சு போட்டுடும் . அதிகபட்சம் லஞ்சம் குடுத்து போலி சாதி சான்றிதல் வேண்டுமென்றால்   வாங்கலாம் . அவ்வளவே , அதுக்கு மேல ஒரு ஹேர்ரையும் புடுங்க முடியாது . இப்போ சொல்லுங்க சாதிதானே பெருசு ? ? ?

எனது கனவு ? அடுத்த பதிவில். . . .

Note :  சாதி = எய்ட்ஸ்  (part-1) படிக்க இங்கே சொடுக்கவும் (click on)
http://rockzsrajesh.blogspot.com/2010/11/1.html

வேதனைகளுடன் ,
ராக்ஸ் . . . .

Tuesday, November 16, 2010 26 comments

                         
               ஆதி மனிதன் உடம்பெல்லாம் முடியோடு பிறந்தான் ,  ஆனால் இன்றைய மனிதனுக்கு பிறக்கும் போது உடம்பில் முடி இல்லை ஆனால் சாதி இருக்கிறது .முடித்தான் சாதியாக மாறி விட்டதோ?  சாதி முடிக்கே சமாணம் .  இன்றைய மனிதன் தனியாக பிறப்பதில்லை , சாதியோடுதான் பிறக்கிறான். எப்போது இருந்து இப்படி ? தெரியல . டிரஸ் போட ஆரம்பிச்சதுக்கு அப்புறம்தான் இப்படின்னு  நினைக்குறேன். அதுக்கு முன்னாடி மனிதன் மனதனாக இருந்தான்.
அப்போது எல்லாம் மனிதன் மிருகங்களிடத்தில் இருந்து தன்னை காப்பாற்றி கொள்ளவே நேரம் சரியாய் இருந்தது. மிருகங்கள் மனிதன் கட்டுபாட்டுக்குள் கொண்டு  வந்த போது ( அதாவது மிருகங்கள் அழிய ஆரம்பித்த போது ... ) மனிதனுக்குள் இருந்த மிருகம் கண் விழிக்க ஆரம்பித்து  இருக்கும் என்று நினைக்குறேன்.

சாதி,  எப்படி இது வந்து இருக்கும்?  

              இது என்னோட சொந்த அனுமானம் , நான் படித்ததில் இருந்து , கேள்வி பட்டதில் இருந்து சொல்ல்கிறேன் .

                பண்டைய காலத்தில் மனிதன் நாகரிக வளர்ச்சி அடைய ஆரம்பித்த காலத்தில் , அவன் அவன், அவன்  அவனுக்கு முடிந்த , தெரிந்த வேலையை ( தொழில் ) செய்ய ஆரம்பித்தார்கள்.  விவசாயம், நெசவு , திருப்பணி , துணிகளை வெளுப்பவர்கள் , பாத்திரம் செய்வது , வியாபாரம், கட்டிட வேலை   இப்படி ஏகப்பட்ட வேலை . அப்போது அவர்களை அடையாள படுத்துவதற்காக அவர்கள் செய்யும் தொழில் பெயரை சொல்லி  அழைக்க , அடையாள படுத்த  ஆரம்பித்தார்கள் என்று நினைக்குறேன் . அதுவே சாதியாக மாறிவிட்டது , அதுவே குல தொழில் ஆனது.
                        உதாரணத்துக்கு  நான் சின்ன வயசா  இருக்கும் போது என்னோட பக்கத்துக்கு வீட்டுல மிட்டாய் செய்யும் குடுப்பம் குடி இருந்தார்கள் . வீட்ல மிட்டாய் செய்து கடைகளுக்கு விநியோகிப்பார்கள். அவர்கள் வீட்டுக்கு போனால் எப்போதும் மிட்டாய் வாசம் அடிக்கும் எனக்கு இன்னும் நினைவிருக்கிறது, தொண்டை இனிக்கிறது . எப்போ போனாலும் பாசத்தோட மிட்டாய் குடுப்பார்கள். அவர்கள் வீட்டு  பையனோடதான் நான் பெரும்பாலும் விளையாடுவேன். அதனால என்னோட வீட்டுல எங்கடா போன அப்படின்னு கேட்டா மிட்டாய்காரங்க வீட்டுல விளையாண்டுக்கிட்டு இருந்தேன் அப்படின்னு சொல்லுவேன் . வீட்டுலயும் அப்படிதான் , என்னை எங்கன்னு கேட்டா மிட்டைகரங்க வீட்டுல விளையாண்டுகிட்டு  இருப்பான் அப்படின்னு சொல்லுவாங்க. அந்த தெருவில் எல்லாரும் அப்படிதான் சொல்லுவாங்க மிட்டாய்காரங்க   வீடுன்னு . அது அவர்கள் செய்யும் தொழில் , அது ஒரு அடையலாம் அவர்களுக்கு அவ்வளவே.  
             அப்படிதான் மற்ற தொழில் செய்பவர்களுக்கும் ஆதி காலத்தில் அவர்கள் செய்யும் தொழிலை பொருத்து அடையாள படுத்த பட்டார்கள்.  ஒரு தொழில் செய்யும் குடும்பத்தில் பிறந்த ஒருவன் அவனுக்கு பிடித்த , முடிந்த தொழில் செய்யும் போது அவன் அந்த தொழில் செய்பவன் ஆகிறான், ஆனால், உதரணத்துக்கு  விவசாயம் செய்யும் ஒருவன் குடும்பத்தில் பிறந்த ஒருவன்  , துணி நெய்தாலோ , இல்லை வேற தொழில் செய்தலோ அவன் அந்த தொழிலை சார்ந்தவன் ஆகிறான். அது அவன் சொந்த விருப்பம் , ஆனால் அவன் ஒரு தொழில் செய்யும் குடுபத்தில் பிறந்து , அவன் அவனுடைய குல தொழில் செய்யாமல் வேற தொழில் செய்தால் அவன் அந்த தொழில் சார்ந்த சாதி என்று இந்த சமுதாயம் ஒத்துக்கொள்ளுமா?   அவன் அந்த தொழிலை செய்பவன் , அந்த சாதி என்று ஒத்துக்கொள்ளுமா? . இல்லை
                  உதாரணத்துக்கு இன்றைக்கு பெரிய காலணி செய்யும் நிறுவனத்தின் உரிமையளர் அந்த சாதி சேர்த்தவர் என்று சொல்ல முடியுமா? இல்லை இன்று வியாபாரம் செய்யும் எல்லாரும் அந்த அந்த சாதியை சேர்ந்தவர்கள்தான? 

    சரி அப்போ ஒருவன் பிறந்த குடும்பத்தின் குல தொழில் தான் சாதி என்றால் , ஏதோ ஒரு தலை முறைலதான் அவங்க அந்த தொழிலை ஆரம்பிச்சு இருப்பாங்க . அதனால இப்போ அதே வழிக்கு வரேன் , இப்போ ஒருத்தர் டாகடர் , அவருக்கும் அவர் மனைவிக்கும் ஒரு குழந்தை பொறக்குது , இப்போ அந்த டாக்டர் அவரோட குழந்தைய கொண்டு போய் தாசில்தார் ஆபீஸ்ளையும் , university ளையும் போய் தன்னோட குழந்தையும் டாக்டர் அப்படின்னு பதிவு செய்ய முடியுமா? அதை இந்த சமுதாயம் ஏற்குமா? இந்த அரசாங்க அதை ஒத்துக்கொண்டு அந்த குழந்தையும் டாக்டர் தான் அப்படின்னு சர்டிபிகேட் குடுக்குமா?
         என்னையா  இது முட்டாள் தனமா இருக்கு நீ டாக்டர் என்கிறதுக்காக உனக்கு பொறந்த குழந்தையும் டாக்டர் ஆகுமா ? அப்படியென்று கேட்க மாட்டாங்க , அவரை ஏளனம் செய்ய மாட்டாங்க ?
இதே மாதிரி engineer  குழந்தை engineer என்று சொல்ல முடியுமா?
வக்கீல் குழந்தை , வக்கீல் என்று   சர்டிபிகேட் வாங்க முடியுமா?
அதற்கான கல்வியை முறையாக படித்து பட்டம் வாங்கினால் மட்டுமே அந்த குழந்தை டாக்டர் ஆகவோ , engineer  ஆகவோ , வக்கீல் ஆகவோ இல்ல இன்னும் மற்ற துறையை சார்ந்த நிபுணர் ஆகவோ அங்கீகரிக்க படுக்கிறது , இந்த சமுதாயத்தாலும் , மக்களாலும் ஏற்று கொள்ள படுகிறது , இல்லையென்றால் அவன் போலி ஆகிறான் . போலி டாக்டர் , போலி வக்கீல் போல , இல்லையா?
பெயர்க்கு பின்னால் போட்டுக்கொள்ள,  இல்ல சொல்லி கொள்ள , சாதி என்ன படித்து வாங்கின பட்டமா?
அப்போறம் எப்படியா ஒருவனுக்கு பொறந்த குழந்தை ஒன்னுமே பண்ணாம அந்த அப்பனுடைய  சாதிய சேர்ந்தது ன்னு சொல்லுரிங்க?
அந்த குழந்தை அந்த அப்பனுக்கு பொறந்தது என்பதற்காக மட்டுமே ?
பைத்தியகார தனமா இல்ல?
எங்கே இருந்து ஆரம்பிச்சு இருந்தா சாதி , சாதி வெறி ? தெரியல எங்கையோ , எப்போவோ , ஏதோ ஒரு சுயநலம் படைத்த கூட்டம் இதை ஆரம்பித்து இருக்க வேண்டும் . அவர்களின் சொந்த லாபத்திற்காக ஆரம்பித்த சதி வேலை இது . உயர்ந்த சாதி , தாழ்ந்த சாதி , நடு சாதி அப்படின்னு .  சரி சாதியே இல்லைக்குறேன் அப்புறம்  என்ன உயர்ந்த , தாழ்ந்த , எல்லாம்? 

இன்னும் விரிவாக மற்றும் தலைப்பின் காரணத்தையும் அடுத்த பதிவில் தொடர்கிறேன்.

எனது கனவு ? அடுத்த பதிவில் :

சாதி = எய்ட்ஸ்  (part-2) படிக்க இங்கே சொடுக்கவும் (click on)
http://rockzsrajesh.blogspot.com/2010/11/1.html



வேதனைகளுடன் ,
ராக்ஸ் . . . .

Tuesday, November 9, 2010 8 comments


இளமையில் தனிமை ,

கொடுமையிலும் கொடுமை 

சவுதி வாழ்கை . . . .   


தனிமையில் , 

ராக்ஸ் . . . .

6 comments

காதல் இந்த வார்த்தைய கேட்டாலே  மனசுக்குள் மத்தாப்பூ பூக்கும் , ஆனா இந்த காதலை  நம்ப பசங்க எப்படி எல்லாம் சொதப்புறங்க இல்ல?. அதுவும் இந்த காதலை   சொல்லுற  சொதபல்ஸ் இருக்கே அதுக்கு தனியா  ஒரு புக் எழுதலங்க.
                   என்னோட நண்பன் ஒருத்தன் இப்படிதான் காதலை  சொல்ல போனான் ஒரு பொண்ணுகிட்ட  , போய் காதலை   சொல்லுவான் ன்னு பார்த்த இவன்பாட்டுக்கு அவனோட வாழ்கை வரலாற சொல்ல ஆரம்பிச்சுட்டான் பாவம் அந்த பொண்ணு இவனோட ராமாயணத்தா  கேக்க முடியாம , சொல்லாம கொல்லாம எஸ்கேப் ஆகிடுச்சு  . இது தெரியாம இவன் மண்ணை பார்த்து சொல்ல ஆரம்பிச்சவன் அவனோட வரலாற அந்த பொண்ணு போனதுகூட தெரியாம ஒரு மணி நேரமா மரத்துக்கிட சொல்லிட்டு  வந்து இருக்கான்.
                      இன்னொரு நண்பன் காதலை  சொல்லிட்டு வாட ன்னு  வீரத்த ஏத்தி அனுப்பி வச்சா   இவன்பட்டுக்கு அதே  வீரத்தோடையே போய் கட்ட பொம்மன்  மாதிரி வசனம் பேசிட்டு வந்து இருக்கான்.  பாவம் அந்த புள்ள, பச்சை மண்ணு , இவன பேசுன வீர வசனத்த  கேட்டு  பயந்து போய் ஒரு வாரம் காயச்சல படுத்துடுச்சு.
                        இது இப்படி இருக்க நான் காலேஜ் படிக்கும் போது ஒரு வெவரமான பொண்ணு , என்னோட நண்பன் ஒருத்தன் போய் செம ரொமாண்டிக் மூட் ல அந்த பொண்ணுகிட்ட காதலா சொல்லி இருக்கான் , அந்த பொண்ணு உடனே ரொம்ப வெக்க பட்டுக்கிட்டு நீங்க முதல்ல இருக்க அரியர் பேப்பர் எல்லாம் கிளியர் பண்ணுங்க அப்பதான் உங்க காதல ஏத்துக்குவேன்னு  தெளிவா சொல்லிடுச்சு , இத கேட்ட உடனே எனக்கு வந்துச்சு பாருங்க கோவம் , நேர அந்த பொண்ணுகிட்ட போய் " ஏய்  என்ன இது சின்ன புள்ள தனமா இருக்கு ? ஒண்ணு புடிச்சு இருந்த புடிச்சு இருக்குனு சொல்லு , இல்ல புடிக்கலைய புடிக்கலன்னு சொல்லு , அத விட்டுபுட்டு அதென்ன அரியர்ஸ் எல்லாம் பாஸ்  பண்ண சொல்லி இருக்கா? " அப்படின்னு கேட்டதுக்கு அந்த பொண்ணு அதுக்கும் வெக்க பட்டுகிட்டே என்கிட்ட  சொல்லுச்சு " எல்லாம் அவர் மேல இருக்க நம்பிக்கைனாலதான்னு" . அதுக்குள்ள அவரா? நம்பிக்கையா? அப்படின்னு எனக்கு தூக்கி வாரி போட்டுச்சு . எந்த நம்பிக்கைனால அப்படி சொன்னேன்னு கேட்டதுக்கு , எப்படியும் அவர் அரியர் பேப்பர் எல்லாம் பாஸ் பண்ண மாட்டருன்கிற நம்பிக்கைதான்னு அதே வெக்கத்தோட சொல்லிட்டு  போகுதுன பாத்துகோங்களேன். எவ்வளவு நம்பிக்கை என்ன நண்பன் மேலன்னு என்னக்கு கண்ணுல தண்ணி வச்சுடுச்சு. முடியலட சாமி பொண்ணுங்க நம்பள அநியாத்துக்கு புரிஞ்சு வச்சு இருக்காங்க.
                ஆனா இந்த பொண்ணுங்கள மட்டும் நம்பவே கூடாது பாஸ் , கடைசி நிமிசத்துல எப்படிதான் எஸ்கேப் ஆவங்கனே தெரியாது , கரெக்ட்ட எஸ்கேப் ஆகிடுவாங்க . இப்படி தான் என்னோட சீனியர் ஒருத்தர் எங்க செட் பொண்ணுகிட்ட  லவ்வ  சொல்லுறேன் ன்னு தனிய லேப்க்கு கூட்டிட்டு போயிட்டாரு , கரெக்டா,  வாங்கி வச்சு இருந்த பூங்கொத்த எடுத்து i love wwooooooooo ன்னு அடச்சா,  i  love  you  ன்னு சொல்ல போற நேரத்துல கம்ப்யூட்டர் சயின்ஸ் மேடம் வராத அந்த புள்ள பாத்துட்டு சைக்கிள் கேப்ல எஸ்கேப் ஆகிடுச்சு , நம்ப சீனியர் அண்ணே பூங்கொத்த எடுத்து  டைமிங்க  ரய்மிங்க i love you  சொல்லும்போது கம்ப்யூட்டர் மேடம் கதவ திறந்துட்டு முன்னாடி நிக்குது .  அப்போ சீனியர் முகத்த  பார்கன்னுமே ஐயோ ஐயோ . ஆனா  அந்த மேடம் கொஞ்சம் கூட சலனம் இல்லாம " கம் டு மை ரூம்"  ன்னு சொல்லிட்டு போய்டுச்சு , அந்த மேடம் ரூம் க்கு போயிட்டு ஒரு ஒரு மணி நேரம் கழிச்சு சீனியர் பேய் அடிச்சா மாதிரி வெளிய வந்தாரு , என்னணே என்ன ஆச்சுன்னு கேட்டதுக்கு ஒரு மணி நேரம் செம ரெய்டு மச்சி , லவ்வ சொல்லுறவன் இப்படி பப்ளிக்வா சொல்லுவா? தனிய வந்து சொல்ல கூடாது ன்னு மேடம் காண்டகிடங்கடன்னு, இத கேட்டு நாங்க பேய் அடிச்சா மாதிரி ஆகிட்டோம் , சரி விடுங்கண்ணே நீங்க ஜூனியர்ற கரெக்ட் பண்ணலாம்ன்னு பாத்திங்க ஆன உங்க கேரக்டர்க்கு  , உங்கள கரெக்ட் பண்ண ஒரு சீனியர் மேடம் இருகாங்ககுறது இப்பதான் தெரியுது . சரி என்ஜாய் பண்ணுங்கண்ணேன்னு சமாதனா படுத்தி அனுப்புறதுக்குள்ள போதும் போதும்ன்னு ஆகிடுச்சு .
                   இப்போ இன்னொரு பையன் எங்களோட ஜூனியர் பையன் , அவன் போய் ஒரு சீனியர் வட நாட்டு பொண்ணுக்கிட்ட  லவ்வ சொல்லுறேன்னு தமிழ்ல கவிதை சொல்லி பொலம்ப , அந்த பொண்ணுக்கு தமிழ் தெரியாது, இவனுக்கு இங்கிலீஷ் அவசரத்துக்கு கூட வராது , அந்த பொண்ணு இவன் ஜூனியர் பையன் ஏதோ பசிலதான் பொலம்புரன்னு நினைச்சுக்கிட்டு காலேஜ் காண்டீன்னுக்கு கூட்டிட்டு போய் டீ யும் பன்னும் வாங்கி கொடுத்து சாப்பிட வச்சு அனுப்பி இருக்கு .
              அட இத விடுங்க என்னை எடுத்துகோங்க , நானெல்லாம் லவ்வ சொல்ல நைட் பூர 45 தடவ ரிகர்சல் பாத்துட்டு போனல்லும் , அந்த பொண்ணுங்க முன்னாடி போய் நின்னதும் அது எப்படி தான்ன்னு தெரியல அப்படியே இன்ஜினியரிங் மாத்ஸ்  எக்ஸாம் பேப்பர் கைல வாங்குன மாதிரியே இருக்கும் , மண்டைல ஒன்னும் ஓடாது . நாக்கு கோளாறும் , கை வேர்த்து போகும் , பேண்ட்டுக்குள்ள கால் மட்டும் தனியா டான்ஸ் ஆடும் ஆன வெளிய தெரியாது .   நீ போட்டு இருக்க சுடிதார் நல்ல இருக்கு , காலைல என்ன சாப்பிட்ட ? , இன்னைக்கு மெஸ் ல சாப்பாடு நல்லவே இல்ல தெரியுமா? அப்படின்னு சம்பந்தம் சம்பந்தமே இல்லாம ஒளரிட்டு வருவேன் . அதெல்லாம் ஒரு காலம் .
                         இந்த காதல்ல  நடக்குற சொதபல் , கலாட்டாவா எத்தனையோ சினிமால பார்த்து இருக்கோம் . ஆன இதையே ரெண்டு புதிய இயக்குனர்கள் குறும்படம எடுத்து இருக்காங்க , சினிமாவுக்கு நாம்ப தர முக்கியத்துவத்த , குறும்படங்களுக்கு ஏனோ நாம தருவது  இல்ல , அதனால நல்ல புதிய இயக்குனர்களுக்கு அங்கீகாரமும் , புகழும் கிடைப்பதில்லை . அதனால இங்க ரெண்டு குறும்படங்கள இங்க உங்க பார்வைக்கு வைக்குறேன் , இதுக்கு முன்னாலையே இத நீங்க பார்த்து இருக்கலாம் இருந்தாலும் எனக்கு புடிச்சு இருக்கிறதுனால இங்க இணைத்து இருக்கிறேன் , பார்க்காதவர்கள் பார்த்து என்ஜாய் பண்ணுங்க . 

1. காதலில் சொதப்புவது   எப்படி?







2 . துரு




காதலுடன் ,
ராக்ஸ் ..........
For fun chat, blog, forum, videos, games, live FM  kindly visit our website:  www.tamilrockzs.com  

Saturday, October 30, 2010 0 comments


Dear Friends,
Recently I got two interesting e-mail which i am sharing here : 
E-mail : 1

Bill Gates decides to Sell OFF Microsoft





Why Bill Gates decides to Sell OFF Microsoft?

Letter from Banta Singh of Punjab to Mr. Bill Gates of Microsoft 

Subject: Problems with my new computer
Dear Mr. Bill Gates,
We have bought a computer for our home and we have found some problems, which I want to bring to your notice.  
1. There is a button 'start' but there is no 'stop' button. We request you to check this.
2. One doubt is whether any 're-scooter' is available in system? I find only 're-cycle', but I own a scooter at my home.
3. There is 'Find' button but it is not working properly. My wife lost the door key and we tried a lot trace the key with this 'find' button, but was unable to trace. Please rectify this problem.
4. My child learnt 'Microsoft word' now he wants to learn 'Microsoft sentence', so when you will provide that?
5. I bought computer, CPU, mouse and keyboard, but there is only one icon which shows 'My Computer': when you will povide the remaining items?
6. It is surprising that windows says 'MY Pictures' but there is not even a single photo of mine. So when will you keep my photo in that.
7. There is 'MICROSOFT OFFICE' what about 'MICROSOFT HOME' since I use the PC at home only.
8. You provided 'My Recent Documents'. When you will provide 'My Past Documents'?
9. You provide 'My Network Places'. For God sake please do not provide 'My Secret Places'. I do not want to let my wife know where I go after my office hours.
Regards,
Banta
Last one  to Mr Bill Gates :
Sir, how is it that your name is Gates but you are selling WINDOWS?
*********************************************************************************


E-mail : 2


Words longest website address : 


http://www.llanfairpwllgwyngyllgogerychwyrndrobwllllantysiliogogogoch.com/

Llanfairpwllgwyngyllgogerychwyrndrobwllllantysiliogogogoch.com is the  
longest single word (without hyphens) .com domain name in the world. 
It was registered by Internetters on 21st October 1999.
This Welsh town actually exists and its name translates as "The church of St. Mary 
in the hollow of white hazel trees near the rapid whirlpool by St. Tysilio's of the red cave".
For brevity, it is understandable that many of the locals simply refer to their village as
"Llanfair" www.llanfair.com or "Llanfair PG" or "Llanfairpwll" which, of course, makes for
easier typing and is faster to pronounce.
Prior to October 1999 it was not possible to register .com domain names longer than 
26 characters (including 4 for the .com suffix). This denied many businesses and 
organisations the ability to register their full trading names as a .com domain name. 
However in October 1999, 
it became possible to register domain names up to 67 characters in length 
(including the 4 for the .com suffix).
Companies with names such as Cheltenham and Gloucester were then able to secure 
their trading names with a .com suffix www.cheltenhamandgloucester.com 
(27 characters). For more information about places of interest or associated with llanfairpwllgwyngyllgogerychwyrndrobwllllantysiliogogogoch
but this is well less known.
And finally, sadly even the 67 character allowance for a .com domain name is still 
insufficient for the town of  
Tetaumatawhakatangihangakoauaotamateaurehaeaturipukapihimaungahoronu
kupokaiwhenuaakitanarahu
in New Zealand with a staggering 92 characters however even this seems positively tiny 

compared to the town of
Krungthepmahanakornamornratanakosinmahintarayutthayamahadilokphop
nopparatrajathaniburiromudomrajaniwesmahasatharn
amornphimarnavatarnsathitsakkattiyavisanukamprasit
in Thailand which is a whopping 163 characters long so long that it doesn't even fit on
one line!  However whilst the New Zealand place name is recognised by the Guiness 
Book of Record, the Thailand name is not.
Other long names (but not place names) include words such as 
© Copyright Internetters Limited 1998-2003. All Rights Reserved
Internetters domain name registration and web hosting specialists since 1998

With smile,
rockzs....

For fun chat, blog, forum, videos, games, live FM  kindly visit our website:  www.tamilrockzs.com 





Sunday, October 24, 2010 5 comments


hi friends ,
This time I came with a Young Sardarji  Joke .
There was a young Sardarji boy who was studying  in  5th STD in the age of 15 (he got  failed many time  sir, so don’t calculate the age ) . One  day in his mathematics  class,  teacher was teaching addition
“1+1 = 2 ,
2+2 = 4 ,
3+3 = 6 “
 Now teacher asked sardarji boy  "so tell me,  20 + 20 how much? “  , young sardarji replied அஸ்க்கு  புஸ்சுக்கு ஈஸியானத  மட்டும்  நீங்க  சொல்லிடுவிங்க,
கஷ்டமானத  என்ன்கிட்ட கேப்பிங்களா? " . teacher got angry but didn’t showed to him,  then she asked him again " ok fine let me ask you simple one.  tell me , 2+2 = how much?
sadarji boy replied immediately  " 2+2 = 22 madam " teacher got damn angry and asked him to turn back and beat  his bum   with wooden scale nicely
sadarji  boy got damn  pain and its burning  also , sardarji boy rubbed his bum and parked it on his seat, after  reaching his home,  directly he gone to his room and closed the door,  Opened his trouser and seen his back in front of the mirror.   Ohh my god……. ,  sardarji boy got shocked  and angrily shouted   " Bloody teacher broken my bum into two " …….. 
lol
With smile,
rockzs....

For fun chat, blog, forum, videos, games, live FM  kindly visit our website:  www.tamilrockzs.com 

Sunday, October 17, 2010 24 comments

ஜோக்ஸ்.....
ஹாய் friends , இந்த டைம் ஜோக்ஸ் சொல்ல வந்து இருக்குறேன் . கண்டிப்பா நீங்க எல்லாம் ரசிப்பிங்ககுற நம்பிக்கைல நல்ல ஜோக்ஸ்சுடன் ராஜேஷ் .....
1 ) ஒருத்தன் காலங்காத்தால டாக்டர் கிட்ட போய் " டாக்டர் , டாக்டர் நான் நேத்து நைட் பயங்கரமான கனவு கண்டேன் டாக்டர் " அப்படினான். டாக்டர் கடுப்பாயட்டாறு. சரி இருந்தாலும் அதெல்லாம் வரவங்க கிட்ட காட்ட முடியாது இல்ல . அதனால முகத்த சாந்தமா வச்சுக்கிட்டு  டாக்டர் சொன்னாரு " நீங்க ஒன்னும் டென்ஷன் ஆகாம,  அப்படி என்னதான் பயங்கரமான கனவு கண்டிங்கன்னு சொல்லுங்க " அப்படினாரு . அதுக்கு அவன் சொன்னான் " டாக்டர் நைட் நான் தூங்கும் போது ஒரு பெரிய பன்னு(Bun)  அதாவது பெரிய பிரட் சாப்பிடுற மாதிரி கனவு கண்டேன் டாக்டர் " அப்படினான் . அதுக்கு டாக்டர் ஊச்ஸ்ஸஷப்பா ...... இப்பவே கண்ணே கட்டுதேன்னு வடிவேலு ஸ்டைலேல நினைச்சுகிட்டு அதையும் வெளிய காட்டிக்காம சொன்னாரு " பிரட் சாப்பிட்ட ஒடம்புக்கு நல்லதுதான் இதுக்கு போய் ஏன் டென்ஷன் ஆகுரிங்க ? பீஸ் 100 ருபீஸ் குடுத்துட்டு நிமதிய கிளம்புங்கன்னு  சொன்னாரு டாக்டர் . அதுக்கு அவன் சொன்னான் " டாக்டர் அது இல்ல டாக்டர் நைட் தூங்கும் போது பெரிய பிரட் சாபிடுற மாதிரி கனவு கண்டேனா , விடிஞ்சு காலைல எழுந்துரிச்சு பார்த்த தலைக்கு வச்சு படுத்து இருந்த தலகாணிய காணாம் டாக்டர் !!!!!!!! "  அப்படினான் .

*************************************************************************************************
சிரிங்க சிரிங்க சிரிசுகிடே இருங்க ....மீண்டும் உங்கள வேற நல்ல ஜோக்ஸ் கூட சந்திக்கும் வரை..............
சிரிப்புடன் ,
ராக்ஸ். . ..

For fun chat, blog, forum, videos, games, live FM  kindly visit our website:  www.tamilrockzs.com

8 comments


பாஸ் என்கிற பாஸ்கரன் ......
சமீபத்தில் வெளிவந்து திரையில் ஓடிகொண்டிருக்கும் படம் . போஸ்டர் banner எல்லாம் பார்த்தேன் நடிகர் ஆரியா , நயன்தாரா செம பிரெஷா இருந்தாங்க . trailer வித்தியாசமாக இருந்தது. படம் நல்ல இருக்கு, ஆரியா சூப்பர், படம் பாக்கலாம் அப்படின்னு என்னோட நண்பர் ஒருத்தர் கூட சான்றிழதல் கொடுத்தாங்க . சரின்னு நானும் படம் பார்க்க ஆரம்பிச்சேன் . ஆரியா கலக்கலா அறிமுகம் ஆகிறார் . ஒபென்னிங் பாடல் வேற . கதை கும்பகோணத்தில் நடபதாக . ஆரியா அறியர் எக்ஸாம் எழுத போகும் போது நயன்தாராவை பேருந்தில் பார்க்கிறார் . ஆனால் எனக்கு ஒன்னு மட்டும்தான் புரியல பரீட்சை எழுத போற ஆர்யாதான் அந்த இங்கிலீஷ் புக் வச்சு இருக்கார்னா , எக்ஸாம்க்கு supervisor ஆகா போற நயன்தாராவும் அதே இங்கிலீஷ் புக் வச்சு படிச்சுகிட்டு போறாங்க பேருந்துல . அதுதான் ஏன்ன்னு தெரியல. ஆரியா இப்படி எல்லாருக்கும் தெரியுற மாதிரியா மொக்கைய பிட்டு எடுத்துகிட்டு போவாரு? லாஜிக் கொஞ்சம் கூட இல்லைங்க . இப்படி பொறுப்பில்லாத ஊரை சுற்றும் கதாநாயகன். ஆரியா என்ன செய்ய போராருனே  தெரியாம கதை போகுது . கூட இருக்கும் சந்தானம் அப்போ அப்போ கிச்சு கிச்சு மூட்டுகிறாரு. இப்படி படம் பாத்துகிட்டு இருக்கும் போதே,  எனக்குள்  ஒரு உணர்வு இந்த படத்த எங்கையோ இதுக்கு முன்னாடி பார்த்த மாதிரி . கொய்யா  அப்புறம்தான் தெரிஞ்சது இந்த இயக்குனர் ராஜேஷ் இதுக்கு முன்னாடி ஒரு படம் எடுத்து இருகருன்னு  . அட " Figure முக்கியமா?  இல்ல (சிக்கன்) பீஸ் முக்கியமான்னு?  கேட்டதுக்கு பீஸ்தான் முக்கியம்ன்னு" நல்ல கருத்த சொன்ன SMS அதாங்க " சிவா மனசுல சக்தி " படத்தோட இயக்குனர். என்ன கொடுமை இது? அந்த படத்த பார்த்துட்டே நான் நொந்து போய் வந்தேன் தியேட்டர்ற விட்டு . இது தெரியாம இந்த படாத இவ்வளவு நேரம் பார்த்துடமேன்னு இருந்தது . இது முன்னாடியே தெரிஞ்சு இருந்த இதனை நேரம் வேஸ்ட் ஆகி இருக்காது.
முடியலடா சாமி
இதுக்கு எம். ஜி . ஆர் ரோட குலேய்பகவளி படாத இன்னொருதடவ பார்த்து இருக்கலாம் 


டைரக்டர் சார் அது எப்படி சார் 1st படம் மாதிரியே 2nd படத்தையும் எடுத்திங்க? கரெக்டா சொல்லனும்ன்ன  BOSS க்கும் , SMS க்கும் 6 வித்தியாசம் கண்டு புடிக்கலாம் குமுதம் நாளிழிதலா வர 6 வித்தியாசம் கண்டு புடிக்குற மாதிரி .
1 ) SMS சென்னைல நடக்குது கதை , BOSS கும்பகோணத்தில் நடக்குது .
2 ) SMS ல கதாநாயகனுக்கு அண்ணன் கிடையாது . கதாநாயகிக்கும் அக்கா கிடையாது . ஆனா BOSS ல கதாநாயகனுக்கு அண்ணனும் , கதாநாயகிக்கு அக்காவும் இருக்காங்க .
அட என்னங்கட இது 6 வித்தியாசம் கூட வரல
எல்லாம் ஹெட் லெட்டர்

****************************************************************************************************
இப்ப பாருங்க SMS படம்மும் , BOSS படம்மும் எப்படி ஒரே மாதிரி இருக்குனு சொல்லுறேன் . ரெண்டு படத்துலயும் ஹீரோக்கு அப்பா இல்ல அம்மா , ஒரு தங்கச்சி இருகாங்க. கதாநாயகிக்கு அம்மா இல்ல அப்பா மட்டும்தான் அவரும் சரியான மாங்கவ இருகாங்க . ரெண்டு படத்துலயும் ஹீரோ பொறுப்பில்லாம சுத்துறாங்க . ரெண்டு ஹீரோவ்வும் செம நக்கல் பார்டிங்க , யாருக்கும் அடங்க மாட்டாங்க . ரெண்டு ஹீரோவுக்கும் நண்பன் சந்தானம்தான் . ரெண்டு ஹீரோவ்வும் சந்தானத்தா முழி பிதுங்க டார்ச்சர் பண்ணுறாங்க. ரெண்டு கதாநாயகிகளும் நல்ல படிச்சு ,  decent ஆனா வேலைல இருக்கவங்க ஆனா கொஞ்சம் கூட தகுதியே இல்லாத கதாநயகன காதல் பண்ணுறாங்க . ரெண்டு ஹீரோவ்வும் திருந்தவே மாட்டோம் கடைசி வரைக்கும் இப்படியேதான் இருப்போம்ன்னு அடம்புடிக்கிறதா காட்டி இயக்குனர் மற்ற பட ஹீரோக்களிடம் இருந்து வித்தியாச படுதுவத  நினைச்சுகிட்டு படம் பாக்குறவங்க எரிச்சல் அடைய செய்யுறாரு . கடைசி வரைக்கும் ரெண்டு ஹீரோவும் எதையும் சாதிக்கலேன்னா கூட பரவால்லை , அடிப்படை விஷியங்கள் கூட செய்ய மறுக்கிறார்கள் . என்னதான் காமெடி பட எடுப்பதா இருந்த கூட கொஞ்சமாவது லாஜிக் இல்லைனாலும் எரிச்சல் அடைய செய்யாமலாவது இருக்கலாம் .
[ பின் குறிப்பு : இந்த ரெண்டு படமும் இந்த ஹீரோக்கள் போல குணநலன்கள் கொண்டவர்களுக்கு புடிச்சு இருக்குறத சொல்லுறாங்க. என்னவோ தெரியலைங்க ... ]
அன்புடம்,
ராஜேஷ். ( நான் இந்த படத்தோட இயக்குனர் இல்லைங்கோ..... )





For fun chat, blog, forum, videos, games, live FM  kindly visit our website:  www.tamilrockzs.com 

4 comments

மூன்று படங்கள் ஒரு கதை. . . .


1 ) விண்ணைத்தாண்டி வருவாயா , சும்மா சொல்ல கூடாது உண்மைளையே நம்மை விண்ணுக்கு கூட்டிகிட்டு போன காதல் கவிதை இந்த படம் . படம் பார்க்கும் ஒவ்வொருவருக்கும் இப்படி ஒரு காதல் நம்மையும் போட்டு தாக்காதனு ஏங்க வைத்த படம். சிம்பு , த்ரிஷா வின் அட்டகாசமான நடிப்பும் , A . R . ரஹ்மான் இன் மனதை கொள்ளை கொள்ளும் இசை மற்றும் பாடல்கள் . கௌதம் வாசுதேவ மேனோனின் சிறப்பான திரைகதை & இயக்கம்.
சிம்புக்கு இது கண்டிப்பாக ஒரு நல்ல படமாக இருக்கும் அவரோட பட வரிசையில் . த்ரிஷாவ இவ்வளவு அழகாக இதுக்கு முன்னாடி திரையில் பார்த்த நினைவு இல்லை , ஒளிபதிவளருக்கு ஒரு சபாஷ் . படத்தின் முடிவு அழகான வலியுடனான ஒரு கவிதை .

2 ) பாண காத்தாடி , மறைந்த நடிகர் முரளி அவர்களின் மகன் ஆதவாவை கதாநாயகன் ஆக்கி வெள்ளித்திரைக்கு அறிமுக படுத்திய படம் . தலைப்பு எத்த மாதிரி காத்தாடிய பறக்குது கதை . பாடல்கள் வழக்கம் போல் யுவன்னின் சிறப்பான இசை நம்மை தாலாட்டுகிறது . இயக்குனர் பத்ரி வெங்கடேஷ் வித்தியாசமாக முயற்சி செய்து இருக்கிறார். திரைகதை நம்மை நிமிர்ந்து உக்கார வைக்குறது . பிரசன்னா கொஞ்ச நேரம் வந்தாலும் மனதில் நிற்கிறார். படம் பார்க்கலாம் . கிளைமாக்ஸ் மனதை கனக்கிறது .

3 ) காதல் சொல்ல வந்தேன். இயக்குனர் பூபதி பாண்டியன் என்ன சொல்ல வராருனுதான் தெரியல . கதாநாயகன் ஸ்கூல் பையன் மதுரித்தான் இருக்காரு. கதாநாயகி அழகா இருகாங்க . குடுத்த வேலைய செய்து இருகாங்க . பாவம் சரியான வேலைதான் குடுக்கல இயக்குனர் . பாடல்கள் அவ்வுளவா மனசுல நிக்கவில்லை .
டைரக்டர் சார் அது எப்படி சார் ஹீரோ காலேஜ் சேர்ந்த 1st நாள்ல இருந்து ஒரு தரவ கூட கிளாஸ் ரூம் குள்ள போகவே இல்ல . எப்ப பார்த்தாலும் கிளாஸ்க்கு வெளியவே சுத்தி கிட்டு இருக்காரு?
காலேஜ் ல சீனியர் இவ்வளவு மொக்கையவா இருபங்க? அந்த சீனியருங்க 15  நாள் ரூம் போட்டு வெளிய வராம உக்காந்து இருக்குறது எல்லாம் ரொம்ப ஓவர் . முடியல
சில ஜோக்ஸ் எல்லாம் கொஞ்சம் முகம் சுளிக்க செய்கிறது . வழக்கம் போல சோகமான கிளைமாக்ஸ் .
..............................................................................................................................................................
மேல பார்த்த மூணு படங்களும் ஒரே கதை . கொஞ்சம் கூர்ந்து கவனித்தால் தெரியும் .
கதை இதுதான் . கதாநாயகன் , கதாநாயகிய விட வயது சிறியவன் . 1st கதாநாயகனுக்குதான் காதல் வருது மூணு படத்துலயும் . 1st அத ஏற்க மறுக்குறாங்க கதாநாயகி . ரெண்டு பெரும் நண்பர்களா இருக்க முடிவு செய்கிறார்கள் . ஆனா கதாநாயகன் திடீர்னு இல்ல நான் பிரெண்ட் ஆகா இருக்க முடியாது நான் உன்ன காதலிக்குறேன்னு சொல்லுறாரு . ஷாக் ஆனாலும்  கதாநாயகியும் ஒரு தருணத்தில் ஒத்துக்குறாங்க. ஆனா எதிர் பார்க்காத திருப்பதால் காதலர்கள் ஒண்ணு சேர்வது இல்லை முடிவில் . மூன்று படங்களும் காதல் தோல்விய சொல்லுது சோகமான முடிவு ஆனா வேற வேற காட்சி அமைப்புகளால், அவ்வுளவுதான் . அதனால் கதை ஒன்றுதான் படத்தின் பேரு , நடிகர்கள் இயக்குர்கள்தான் வேற வேற .
என்ன ஆச்சு நம்ப தமிழ் இயக்குனர்களுக்கு?
எல்லாரும் ஒரே நேரத்துல ஒரே இங்கிலீஷ் பட DVD பார்த்துடாங்கள?
அன்புடன்,
ராக்ஸ்.....
For fun chat, blog, forum, videos, games, live FM  kindly visit our website:  www.tamilrockzs.com

1 comments


நானும் இன்டர்நெட்டும் ...........
அது ஒரு கனா காலம் , ஸ்கூல் முடிச்சுட்டு காலேஜ் join பண்ணுற சமயம் , ஸ்கூல் ல நான் 1st குரூப் , அதாங்க maths , physics , chemistry & biology இருக்குமே . இந்த அறிவாளி பசங்க எல்லாம் படிபங்கலே அந்த குரூப் . அதுக்காக நான் அறிவாளியனு நீங்க அறிவாளிதனாமா கேள்வி கேக்கபடாது . சரி விஷியத்துக்கு வருவோம் 1st குரூப்னாலே கம்ப்யூட்டர் அறிவெல்லாம் அவ்வுளவா கிடையாது . அதாவது கம்ப்யூட்டர் சயின்ஸ் படிக்குற ஸ்கூல் பசங்களுக்குத்தான் அதெல்லாம் தெரியும் . அதுவும் அப்போ black &white monitor வேற , MS dos ல தான் ப்ரோக்ராம் எல்லாம் பண்ணுவாங்க அந்த பக்கம் போனாலே ஒண்ணும் புரியாது. கம்ப்யூட்டர்ல சன் டிவி தெரியாதன்னு அப்பாவியா கேட்ட காலம் அது . எப்படியோ ஸ்கூல் முடிஞ்சு இன்ஜினியரிங் join பண்ண போறேன் . இன்ஜினியரிங் ல கண்டிப்பா கம்ப்யூட்டர் படிச்சு சாகனும் அடடா இல்ல இல்ல படிச்சாகணும்ன்னு தெரிஞ்சு போச்சு . அப்போதான் கம்ப்யூட்டர் பத்தி தெரிஞ்சுக்க ஆரம்பிச்சேன் . அப்போதான் இன்டர்நெட் அப்படிங்குற ஒன்னு இந்தியாக்கு அறிமுகம் ஆகுற சமயம் . எனக்கு ஒரே ஆர்வம் இன்டர்நெட் பத்தி தெரிஞ்சுக்க . காலேஜ் join பண்ணினேன் 1st இயர்ல. நான் படிச்சா கோயம்புத்தூர்ல இன்டர்நெட் ப்ரொவ்சிங் சென்டர் எல்லாம் வர ஆரம்பிச்ச சமயம் அது . அட அட அட என்ன ஒரு அழகு போங்க . செமைய இருக்கும் . ஒரு புது அனுபவம் அது . அது வரைக்கும் நமக்கு தெரிஞ்சது எல்லாம் சினிமா தியேட்டர் , பார்க் , கோவில் , பீச் , ஹோட்டல் எல்லாம் தான் . இந்த ப்ரொவ்சிங் சென்டரும் , இண்டர்நெட்டும் ஏதோ ஒரு புது உலகத்துக்கு போற மாதுரி இருந்துச்சு . அப்போ என்னோட ப்ரிண்ட்ஸ் கூட discuss பண்ணதுல கொஞ்ச விஷயம் கிடைச்சது . இன்டர்நெட் ல என்ன பண்ணலாம்னு . ஏதோ ஈமெயில் அனுபலாம்ன்னு சொன்னங்க . சரின்னு நானும் போனேன் இன்டர்நெட் ப்ரொவ்சிங் செண்டர்க்கு . போன cabin cabin ஆ இருக்கு . அங்க ப்ரொவ்சிங் சென்டர் owner நம்ப சிரிச்ச முகத்தோட வரவேர்த்தார் . இன்டர்நெட் பாக்கணும்ன்னு சொன்னேன் . 1hr க்கு Rs 100 அப்படிநாரு . என்னக்கு தூக்கி வாரி போட்டுச்சு அன்னைக்குனு பாத்து என்ன பாக்கெட் ல இருந்தது வெறும் 60 ரூபாய் தான் , ஐயயோ இன்டர்நெட் பாத்து முடிச்சுட்டு பணம் பத்துலேன்னா , ஹோட்டல் ல சாப்பிட்டு காசு குடுக்கலேன்னா மாவட்ட சொல்லுற மாதிரி இங்கயும் எதாவது சிஸ்டம் வச்சு இருப்பங்களோ ன்னு என்னக்கு பயம் வேற . உள்ள வரைக்கும் வந்தாச்சு இன்னிமே திரும்பி போன அது நம்ப பரம்பரைக்கு வேற அவமான போய்டும் . என்ன பண்ண ? சரி அப்போ அரை மணி நேரம் தருவிங்களன்னு கேட்டேன் , மருதா முருகன் புண்ணியத்துல அவரும் தருவோம்ன்னு சொன்னாரு , அப்பாடி trouser தப்புச்சதுடன்னு நானும் உள்ள போய் உக்காந்ததும் தான் என்னக்கு தெரிஞ்சது , அங்க என்ன பண்ணுறதுன்னு என்னக்கு தெரியலன்னு . சரி கூச்ச படமா அவர கூபிட்டு கேட்டேன் இன்டர்நெட் எப்படி பாக்குறதுன்னு அவரு என்னமோ பிறக்கும் போதே கைல லேப்டாப் ப்பும் , laptop with 2mps broadband wireless connection  னோட பொறந்த மாதிரி என்ன ஒரு லுக் விட்டுட்டு இன்டர்நெட்க்கு புதுசான்னு கேட்டாரு , நானும் நாலு cabin குள்ள நடக்குற விஷயம் வெளிய நாலு பேருக்கு தெரியாதுங்கிற தும்பிக்கைல அட ச்சா நம்பிக்கைல ஆமானு உண்மைய ஒத்துகிட்டேன். அவரும் பெரிய மனசு பண்ணி என்ன பண்ணனும்ன்னு சொல்லி குடுத்தாரு . அப்போ எல்லாம் hotmail தான் . அவரும் எது ஏதோ details கேட்டாரு நானும் வெக்கபடாம சொன்னேன் , கடைசில எனக்கு ஈமெயில் id ஒன்னு create பண்ணாத சொல்லி ஒரு ஈமெயில் id யும் password டும் குடுத்தாரு அதுக்குள்ள அரை மணி நேரத்துக்கு மேல ஆகிடுச்சுன்னு சொல்லி ஏதோ பெரிய மனசு பண்ணி 50 ரூபாய் மட்டும் போதும்ன்னு சொல்லிடாரு. password எல்லாம் நமக்கு மட்டுமே தெரிஞ்சு இருக்கணும் கூட தெரியல அப்போ . இதுதான் எனது முதல் முதல் ஈமெயில் உருவான வரலாறு ...... [ இப்போ அந்த ஈமெயில் id நினைவு இல்ல :-( ...... ]
இன்னும் இன்டர்நெட் அனுபவங்கள் தொடரும் ............
அன்புடன்,
ராக்ஸ் ....
For fun chat, blog, forum, videos, games, live FM  kindly visit our website:  www.tamilrockzs.com

Related Posts Plugin for WordPress, Blogger...

Follow by Email

My Blog List

My Promoters