Dear Friends,
Recently I got two interesting e-mail which i am sharing here :
E-mail : 1
Bill Gates decides to Sell OFF Microsoft
Why Bill Gates decides to Sell OFF Microsoft?
*********************************************************************************
Subject: Problems with my new computerDear Mr. Bill Gates,We have bought a computer for our home and we have found some problems, which I want to bring to your notice.1. There is a button 'start' but there is no 'stop' button. We request you to check this.2. One doubt is whether any 're-scooter' is available in system? I find only 're-cycle', but I own a scooter at my home.3. There is 'Find' button but it is not working properly. My wife lost the door key and we tried a lot trace the key with this 'find' button, but was unable to trace. Please rectify this problem.4. My child learnt 'Microsoft word' now he wants to learn 'Microsoft sentence', so when you will provide that?5. I bought computer, CPU, mouse and keyboard, but there is only one icon which shows 'My Computer': when you will povide the remaining items?6. It is surprising that windows says 'MY Pictures' but there is not even a single photo of mine. So when will you keep my photo in that.7. There is 'MICROSOFT OFFICE' what about 'MICROSOFT HOME' since I use the PC at home only.8. You provided 'My Recent Documents'. When you will provide 'My Past Documents'?9. You provide 'My Network Places'. For God sake please do not provide 'My Secret Places'. I do not want to let my wife know where I go after my office hours.Regards,
BantaLast one to Mr Bill Gates :Sir, how is it that your name is Gates but you are selling WINDOWS?
E-mail : 2
Words longest website address :
http://www.llanfairpwllgwyngyllgogerychwyrndrobwllllantysiliogogogoch.com/
Llanfairpwllgwyngyllgogerychwyrndrobwllllantysiliogogogoch.com is the
longest single word (without hyphens) .com domain name in the world.
It was registered by Internetters on 21st October 1999.
longest single word (without hyphens) .com domain name in the world.
It was registered by Internetters on 21st October 1999.
This Welsh town actually exists and its name translates as "The church of St. Mary
in the hollow of white hazel trees near the rapid whirlpool by St. Tysilio's of the red cave".
in the hollow of white hazel trees near the rapid whirlpool by St. Tysilio's of the red cave".
For brevity, it is understandable that many of the locals simply refer to their village as
"Llanfair" www.llanfair.com or "Llanfair PG" or "Llanfairpwll" which, of course, makes for
easier typing and is faster to pronounce.
"Llanfair" www.llanfair.com or "Llanfair PG" or "Llanfairpwll" which, of course, makes for
easier typing and is faster to pronounce.
Prior to October 1999 it was not possible to register .com domain names longer than
26 characters (including 4 for the .com suffix). This denied many businesses and
organisations the ability to register their full trading names as a .com domain name.
However in October 1999,
it became possible to register domain names up to 67 characters in length
(including the 4 for the .com suffix).
26 characters (including 4 for the .com suffix). This denied many businesses and
organisations the ability to register their full trading names as a .com domain name.
However in October 1999,
it became possible to register domain names up to 67 characters in length
(including the 4 for the .com suffix).
Companies with names such as Cheltenham and Gloucester were then able to secure
their trading names with a .com suffix www.cheltenhamandgloucester.com
(27 characters). For more information about places of interest or associated with llanfairpwllgwyngyllgogerychwyrndrobwllllantysiliogogogoch
their trading names with a .com suffix www.cheltenhamandgloucester.com
(27 characters). For more information about places of interest or associated with llanfairpwllgwyngyllgogerychwyrndrobwllllantysiliogogogoch
There is a station in Wales called
Gorsafawddachaidraigodanheddogleddollonpenrhynareurdraethceredigion
Gorsafawddachaidraigodanheddogleddollonpenrhynareurdraethceredigion
but this is well less known.
And finally, sadly even the 67 character allowance for a .com domain name is still
insufficient for the town of
Tetaumatawhakatangihangakoauaotamateaurehaeaturipukapihimaungahoronu
kupokaiwhenuaakitanarahu
in New Zealand with a staggering 92 characters however even this seems positively tiny
compared to the town of
insufficient for the town of
Tetaumatawhakatangihangakoauaotamateaurehaeaturipukapihimaungahoronu
kupokaiwhenuaakitanarahu
in New Zealand with a staggering 92 characters however even this seems positively tiny
compared to the town of
Krungthepmahanakornamornratanakosinmahintarayutthayamahadilokphop
nopparatrajathaniburiromudomrajaniwesmahasatharn
amornphimarnavatarnsathitsakkattiyavisanukamprasit
nopparatrajathaniburiromudomrajaniwesmahasatharn
amornphimarnavatarnsathitsakkattiyavisanukamprasit
in Thailand which is a whopping 163 characters long so long that it doesn't even fit on
one line! However whilst the New Zealand place name is recognised by the Guiness
Book of Record, the Thailand name is not.
one line! However whilst the New Zealand place name is recognised by the Guiness
Book of Record, the Thailand name is not.
Other long names (but not place names) include words such as
Pneumonoultramicroscopicsilicovolcanokoniosis (and many others) .
© Copyright Internetters Limited 1998-2003. All Rights Reserved
Internetters domain name registration and web hosting specialists since 1998
Internetters domain name registration and web hosting specialists since 1998
With smile,
rockzs....
For fun chat, blog, forum, videos, games, live FM kindly visit our website: www.tamilrockzs.com