Followers

Saturday, October 30, 2010 0 comments


Dear Friends,
Recently I got two interesting e-mail which i am sharing here : 
E-mail : 1

Bill Gates decides to Sell OFF Microsoft





Why Bill Gates decides to Sell OFF Microsoft?

Letter from Banta Singh of Punjab to Mr. Bill Gates of Microsoft 

Subject: Problems with my new computer
Dear Mr. Bill Gates,
We have bought a computer for our home and we have found some problems, which I want to bring to your notice.  
1. There is a button 'start' but there is no 'stop' button. We request you to check this.
2. One doubt is whether any 're-scooter' is available in system? I find only 're-cycle', but I own a scooter at my home.
3. There is 'Find' button but it is not working properly. My wife lost the door key and we tried a lot trace the key with this 'find' button, but was unable to trace. Please rectify this problem.
4. My child learnt 'Microsoft word' now he wants to learn 'Microsoft sentence', so when you will provide that?
5. I bought computer, CPU, mouse and keyboard, but there is only one icon which shows 'My Computer': when you will povide the remaining items?
6. It is surprising that windows says 'MY Pictures' but there is not even a single photo of mine. So when will you keep my photo in that.
7. There is 'MICROSOFT OFFICE' what about 'MICROSOFT HOME' since I use the PC at home only.
8. You provided 'My Recent Documents'. When you will provide 'My Past Documents'?
9. You provide 'My Network Places'. For God sake please do not provide 'My Secret Places'. I do not want to let my wife know where I go after my office hours.
Regards,
Banta
Last one  to Mr Bill Gates :
Sir, how is it that your name is Gates but you are selling WINDOWS?
*********************************************************************************


E-mail : 2


Words longest website address : 


http://www.llanfairpwllgwyngyllgogerychwyrndrobwllllantysiliogogogoch.com/

Llanfairpwllgwyngyllgogerychwyrndrobwllllantysiliogogogoch.com is the  
longest single word (without hyphens) .com domain name in the world. 
It was registered by Internetters on 21st October 1999.
This Welsh town actually exists and its name translates as "The church of St. Mary 
in the hollow of white hazel trees near the rapid whirlpool by St. Tysilio's of the red cave".
For brevity, it is understandable that many of the locals simply refer to their village as
"Llanfair" www.llanfair.com or "Llanfair PG" or "Llanfairpwll" which, of course, makes for
easier typing and is faster to pronounce.
Prior to October 1999 it was not possible to register .com domain names longer than 
26 characters (including 4 for the .com suffix). This denied many businesses and 
organisations the ability to register their full trading names as a .com domain name. 
However in October 1999, 
it became possible to register domain names up to 67 characters in length 
(including the 4 for the .com suffix).
Companies with names such as Cheltenham and Gloucester were then able to secure 
their trading names with a .com suffix www.cheltenhamandgloucester.com 
(27 characters). For more information about places of interest or associated with llanfairpwllgwyngyllgogerychwyrndrobwllllantysiliogogogoch
but this is well less known.
And finally, sadly even the 67 character allowance for a .com domain name is still 
insufficient for the town of  
Tetaumatawhakatangihangakoauaotamateaurehaeaturipukapihimaungahoronu
kupokaiwhenuaakitanarahu
in New Zealand with a staggering 92 characters however even this seems positively tiny 

compared to the town of
Krungthepmahanakornamornratanakosinmahintarayutthayamahadilokphop
nopparatrajathaniburiromudomrajaniwesmahasatharn
amornphimarnavatarnsathitsakkattiyavisanukamprasit
in Thailand which is a whopping 163 characters long so long that it doesn't even fit on
one line!  However whilst the New Zealand place name is recognised by the Guiness 
Book of Record, the Thailand name is not.
Other long names (but not place names) include words such as 
© Copyright Internetters Limited 1998-2003. All Rights Reserved
Internetters domain name registration and web hosting specialists since 1998

With smile,
rockzs....

For fun chat, blog, forum, videos, games, live FM  kindly visit our website:  www.tamilrockzs.com 





Sunday, October 24, 2010 5 comments


hi friends ,
This time I came with a Young Sardarji  Joke .
There was a young Sardarji boy who was studying  in  5th STD in the age of 15 (he got  failed many time  sir, so don’t calculate the age ) . One  day in his mathematics  class,  teacher was teaching addition
“1+1 = 2 ,
2+2 = 4 ,
3+3 = 6 “
 Now teacher asked sardarji boy  "so tell me,  20 + 20 how much? “  , young sardarji replied அஸ்க்கு  புஸ்சுக்கு ஈஸியானத  மட்டும்  நீங்க  சொல்லிடுவிங்க,
கஷ்டமானத  என்ன்கிட்ட கேப்பிங்களா? " . teacher got angry but didn’t showed to him,  then she asked him again " ok fine let me ask you simple one.  tell me , 2+2 = how much?
sadarji boy replied immediately  " 2+2 = 22 madam " teacher got damn angry and asked him to turn back and beat  his bum   with wooden scale nicely
sadarji  boy got damn  pain and its burning  also , sardarji boy rubbed his bum and parked it on his seat, after  reaching his home,  directly he gone to his room and closed the door,  Opened his trouser and seen his back in front of the mirror.   Ohh my god……. ,  sardarji boy got shocked  and angrily shouted   " Bloody teacher broken my bum into two " …….. 
lol
With smile,
rockzs....

For fun chat, blog, forum, videos, games, live FM  kindly visit our website:  www.tamilrockzs.com 

Sunday, October 17, 2010 24 comments

ஜோக்ஸ்.....
ஹாய் friends , இந்த டைம் ஜோக்ஸ் சொல்ல வந்து இருக்குறேன் . கண்டிப்பா நீங்க எல்லாம் ரசிப்பிங்ககுற நம்பிக்கைல நல்ல ஜோக்ஸ்சுடன் ராஜேஷ் .....
1 ) ஒருத்தன் காலங்காத்தால டாக்டர் கிட்ட போய் " டாக்டர் , டாக்டர் நான் நேத்து நைட் பயங்கரமான கனவு கண்டேன் டாக்டர் " அப்படினான். டாக்டர் கடுப்பாயட்டாறு. சரி இருந்தாலும் அதெல்லாம் வரவங்க கிட்ட காட்ட முடியாது இல்ல . அதனால முகத்த சாந்தமா வச்சுக்கிட்டு  டாக்டர் சொன்னாரு " நீங்க ஒன்னும் டென்ஷன் ஆகாம,  அப்படி என்னதான் பயங்கரமான கனவு கண்டிங்கன்னு சொல்லுங்க " அப்படினாரு . அதுக்கு அவன் சொன்னான் " டாக்டர் நைட் நான் தூங்கும் போது ஒரு பெரிய பன்னு(Bun)  அதாவது பெரிய பிரட் சாப்பிடுற மாதிரி கனவு கண்டேன் டாக்டர் " அப்படினான் . அதுக்கு டாக்டர் ஊச்ஸ்ஸஷப்பா ...... இப்பவே கண்ணே கட்டுதேன்னு வடிவேலு ஸ்டைலேல நினைச்சுகிட்டு அதையும் வெளிய காட்டிக்காம சொன்னாரு " பிரட் சாப்பிட்ட ஒடம்புக்கு நல்லதுதான் இதுக்கு போய் ஏன் டென்ஷன் ஆகுரிங்க ? பீஸ் 100 ருபீஸ் குடுத்துட்டு நிமதிய கிளம்புங்கன்னு  சொன்னாரு டாக்டர் . அதுக்கு அவன் சொன்னான் " டாக்டர் அது இல்ல டாக்டர் நைட் தூங்கும் போது பெரிய பிரட் சாபிடுற மாதிரி கனவு கண்டேனா , விடிஞ்சு காலைல எழுந்துரிச்சு பார்த்த தலைக்கு வச்சு படுத்து இருந்த தலகாணிய காணாம் டாக்டர் !!!!!!!! "  அப்படினான் .

*************************************************************************************************
சிரிங்க சிரிங்க சிரிசுகிடே இருங்க ....மீண்டும் உங்கள வேற நல்ல ஜோக்ஸ் கூட சந்திக்கும் வரை..............
சிரிப்புடன் ,
ராக்ஸ். . ..

For fun chat, blog, forum, videos, games, live FM  kindly visit our website:  www.tamilrockzs.com

8 comments


பாஸ் என்கிற பாஸ்கரன் ......
சமீபத்தில் வெளிவந்து திரையில் ஓடிகொண்டிருக்கும் படம் . போஸ்டர் banner எல்லாம் பார்த்தேன் நடிகர் ஆரியா , நயன்தாரா செம பிரெஷா இருந்தாங்க . trailer வித்தியாசமாக இருந்தது. படம் நல்ல இருக்கு, ஆரியா சூப்பர், படம் பாக்கலாம் அப்படின்னு என்னோட நண்பர் ஒருத்தர் கூட சான்றிழதல் கொடுத்தாங்க . சரின்னு நானும் படம் பார்க்க ஆரம்பிச்சேன் . ஆரியா கலக்கலா அறிமுகம் ஆகிறார் . ஒபென்னிங் பாடல் வேற . கதை கும்பகோணத்தில் நடபதாக . ஆரியா அறியர் எக்ஸாம் எழுத போகும் போது நயன்தாராவை பேருந்தில் பார்க்கிறார் . ஆனால் எனக்கு ஒன்னு மட்டும்தான் புரியல பரீட்சை எழுத போற ஆர்யாதான் அந்த இங்கிலீஷ் புக் வச்சு இருக்கார்னா , எக்ஸாம்க்கு supervisor ஆகா போற நயன்தாராவும் அதே இங்கிலீஷ் புக் வச்சு படிச்சுகிட்டு போறாங்க பேருந்துல . அதுதான் ஏன்ன்னு தெரியல. ஆரியா இப்படி எல்லாருக்கும் தெரியுற மாதிரியா மொக்கைய பிட்டு எடுத்துகிட்டு போவாரு? லாஜிக் கொஞ்சம் கூட இல்லைங்க . இப்படி பொறுப்பில்லாத ஊரை சுற்றும் கதாநாயகன். ஆரியா என்ன செய்ய போராருனே  தெரியாம கதை போகுது . கூட இருக்கும் சந்தானம் அப்போ அப்போ கிச்சு கிச்சு மூட்டுகிறாரு. இப்படி படம் பாத்துகிட்டு இருக்கும் போதே,  எனக்குள்  ஒரு உணர்வு இந்த படத்த எங்கையோ இதுக்கு முன்னாடி பார்த்த மாதிரி . கொய்யா  அப்புறம்தான் தெரிஞ்சது இந்த இயக்குனர் ராஜேஷ் இதுக்கு முன்னாடி ஒரு படம் எடுத்து இருகருன்னு  . அட " Figure முக்கியமா?  இல்ல (சிக்கன்) பீஸ் முக்கியமான்னு?  கேட்டதுக்கு பீஸ்தான் முக்கியம்ன்னு" நல்ல கருத்த சொன்ன SMS அதாங்க " சிவா மனசுல சக்தி " படத்தோட இயக்குனர். என்ன கொடுமை இது? அந்த படத்த பார்த்துட்டே நான் நொந்து போய் வந்தேன் தியேட்டர்ற விட்டு . இது தெரியாம இந்த படாத இவ்வளவு நேரம் பார்த்துடமேன்னு இருந்தது . இது முன்னாடியே தெரிஞ்சு இருந்த இதனை நேரம் வேஸ்ட் ஆகி இருக்காது.
முடியலடா சாமி
இதுக்கு எம். ஜி . ஆர் ரோட குலேய்பகவளி படாத இன்னொருதடவ பார்த்து இருக்கலாம் 


டைரக்டர் சார் அது எப்படி சார் 1st படம் மாதிரியே 2nd படத்தையும் எடுத்திங்க? கரெக்டா சொல்லனும்ன்ன  BOSS க்கும் , SMS க்கும் 6 வித்தியாசம் கண்டு புடிக்கலாம் குமுதம் நாளிழிதலா வர 6 வித்தியாசம் கண்டு புடிக்குற மாதிரி .
1 ) SMS சென்னைல நடக்குது கதை , BOSS கும்பகோணத்தில் நடக்குது .
2 ) SMS ல கதாநாயகனுக்கு அண்ணன் கிடையாது . கதாநாயகிக்கும் அக்கா கிடையாது . ஆனா BOSS ல கதாநாயகனுக்கு அண்ணனும் , கதாநாயகிக்கு அக்காவும் இருக்காங்க .
அட என்னங்கட இது 6 வித்தியாசம் கூட வரல
எல்லாம் ஹெட் லெட்டர்

****************************************************************************************************
இப்ப பாருங்க SMS படம்மும் , BOSS படம்மும் எப்படி ஒரே மாதிரி இருக்குனு சொல்லுறேன் . ரெண்டு படத்துலயும் ஹீரோக்கு அப்பா இல்ல அம்மா , ஒரு தங்கச்சி இருகாங்க. கதாநாயகிக்கு அம்மா இல்ல அப்பா மட்டும்தான் அவரும் சரியான மாங்கவ இருகாங்க . ரெண்டு படத்துலயும் ஹீரோ பொறுப்பில்லாம சுத்துறாங்க . ரெண்டு ஹீரோவ்வும் செம நக்கல் பார்டிங்க , யாருக்கும் அடங்க மாட்டாங்க . ரெண்டு ஹீரோவுக்கும் நண்பன் சந்தானம்தான் . ரெண்டு ஹீரோவ்வும் சந்தானத்தா முழி பிதுங்க டார்ச்சர் பண்ணுறாங்க. ரெண்டு கதாநாயகிகளும் நல்ல படிச்சு ,  decent ஆனா வேலைல இருக்கவங்க ஆனா கொஞ்சம் கூட தகுதியே இல்லாத கதாநயகன காதல் பண்ணுறாங்க . ரெண்டு ஹீரோவ்வும் திருந்தவே மாட்டோம் கடைசி வரைக்கும் இப்படியேதான் இருப்போம்ன்னு அடம்புடிக்கிறதா காட்டி இயக்குனர் மற்ற பட ஹீரோக்களிடம் இருந்து வித்தியாச படுதுவத  நினைச்சுகிட்டு படம் பாக்குறவங்க எரிச்சல் அடைய செய்யுறாரு . கடைசி வரைக்கும் ரெண்டு ஹீரோவும் எதையும் சாதிக்கலேன்னா கூட பரவால்லை , அடிப்படை விஷியங்கள் கூட செய்ய மறுக்கிறார்கள் . என்னதான் காமெடி பட எடுப்பதா இருந்த கூட கொஞ்சமாவது லாஜிக் இல்லைனாலும் எரிச்சல் அடைய செய்யாமலாவது இருக்கலாம் .
[ பின் குறிப்பு : இந்த ரெண்டு படமும் இந்த ஹீரோக்கள் போல குணநலன்கள் கொண்டவர்களுக்கு புடிச்சு இருக்குறத சொல்லுறாங்க. என்னவோ தெரியலைங்க ... ]
அன்புடம்,
ராஜேஷ். ( நான் இந்த படத்தோட இயக்குனர் இல்லைங்கோ..... )





For fun chat, blog, forum, videos, games, live FM  kindly visit our website:  www.tamilrockzs.com 

4 comments

மூன்று படங்கள் ஒரு கதை. . . .


1 ) விண்ணைத்தாண்டி வருவாயா , சும்மா சொல்ல கூடாது உண்மைளையே நம்மை விண்ணுக்கு கூட்டிகிட்டு போன காதல் கவிதை இந்த படம் . படம் பார்க்கும் ஒவ்வொருவருக்கும் இப்படி ஒரு காதல் நம்மையும் போட்டு தாக்காதனு ஏங்க வைத்த படம். சிம்பு , த்ரிஷா வின் அட்டகாசமான நடிப்பும் , A . R . ரஹ்மான் இன் மனதை கொள்ளை கொள்ளும் இசை மற்றும் பாடல்கள் . கௌதம் வாசுதேவ மேனோனின் சிறப்பான திரைகதை & இயக்கம்.
சிம்புக்கு இது கண்டிப்பாக ஒரு நல்ல படமாக இருக்கும் அவரோட பட வரிசையில் . த்ரிஷாவ இவ்வளவு அழகாக இதுக்கு முன்னாடி திரையில் பார்த்த நினைவு இல்லை , ஒளிபதிவளருக்கு ஒரு சபாஷ் . படத்தின் முடிவு அழகான வலியுடனான ஒரு கவிதை .

2 ) பாண காத்தாடி , மறைந்த நடிகர் முரளி அவர்களின் மகன் ஆதவாவை கதாநாயகன் ஆக்கி வெள்ளித்திரைக்கு அறிமுக படுத்திய படம் . தலைப்பு எத்த மாதிரி காத்தாடிய பறக்குது கதை . பாடல்கள் வழக்கம் போல் யுவன்னின் சிறப்பான இசை நம்மை தாலாட்டுகிறது . இயக்குனர் பத்ரி வெங்கடேஷ் வித்தியாசமாக முயற்சி செய்து இருக்கிறார். திரைகதை நம்மை நிமிர்ந்து உக்கார வைக்குறது . பிரசன்னா கொஞ்ச நேரம் வந்தாலும் மனதில் நிற்கிறார். படம் பார்க்கலாம் . கிளைமாக்ஸ் மனதை கனக்கிறது .

3 ) காதல் சொல்ல வந்தேன். இயக்குனர் பூபதி பாண்டியன் என்ன சொல்ல வராருனுதான் தெரியல . கதாநாயகன் ஸ்கூல் பையன் மதுரித்தான் இருக்காரு. கதாநாயகி அழகா இருகாங்க . குடுத்த வேலைய செய்து இருகாங்க . பாவம் சரியான வேலைதான் குடுக்கல இயக்குனர் . பாடல்கள் அவ்வுளவா மனசுல நிக்கவில்லை .
டைரக்டர் சார் அது எப்படி சார் ஹீரோ காலேஜ் சேர்ந்த 1st நாள்ல இருந்து ஒரு தரவ கூட கிளாஸ் ரூம் குள்ள போகவே இல்ல . எப்ப பார்த்தாலும் கிளாஸ்க்கு வெளியவே சுத்தி கிட்டு இருக்காரு?
காலேஜ் ல சீனியர் இவ்வளவு மொக்கையவா இருபங்க? அந்த சீனியருங்க 15  நாள் ரூம் போட்டு வெளிய வராம உக்காந்து இருக்குறது எல்லாம் ரொம்ப ஓவர் . முடியல
சில ஜோக்ஸ் எல்லாம் கொஞ்சம் முகம் சுளிக்க செய்கிறது . வழக்கம் போல சோகமான கிளைமாக்ஸ் .
..............................................................................................................................................................
மேல பார்த்த மூணு படங்களும் ஒரே கதை . கொஞ்சம் கூர்ந்து கவனித்தால் தெரியும் .
கதை இதுதான் . கதாநாயகன் , கதாநாயகிய விட வயது சிறியவன் . 1st கதாநாயகனுக்குதான் காதல் வருது மூணு படத்துலயும் . 1st அத ஏற்க மறுக்குறாங்க கதாநாயகி . ரெண்டு பெரும் நண்பர்களா இருக்க முடிவு செய்கிறார்கள் . ஆனா கதாநாயகன் திடீர்னு இல்ல நான் பிரெண்ட் ஆகா இருக்க முடியாது நான் உன்ன காதலிக்குறேன்னு சொல்லுறாரு . ஷாக் ஆனாலும்  கதாநாயகியும் ஒரு தருணத்தில் ஒத்துக்குறாங்க. ஆனா எதிர் பார்க்காத திருப்பதால் காதலர்கள் ஒண்ணு சேர்வது இல்லை முடிவில் . மூன்று படங்களும் காதல் தோல்விய சொல்லுது சோகமான முடிவு ஆனா வேற வேற காட்சி அமைப்புகளால், அவ்வுளவுதான் . அதனால் கதை ஒன்றுதான் படத்தின் பேரு , நடிகர்கள் இயக்குர்கள்தான் வேற வேற .
என்ன ஆச்சு நம்ப தமிழ் இயக்குனர்களுக்கு?
எல்லாரும் ஒரே நேரத்துல ஒரே இங்கிலீஷ் பட DVD பார்த்துடாங்கள?
அன்புடன்,
ராக்ஸ்.....
For fun chat, blog, forum, videos, games, live FM  kindly visit our website:  www.tamilrockzs.com

1 comments


நானும் இன்டர்நெட்டும் ...........
அது ஒரு கனா காலம் , ஸ்கூல் முடிச்சுட்டு காலேஜ் join பண்ணுற சமயம் , ஸ்கூல் ல நான் 1st குரூப் , அதாங்க maths , physics , chemistry & biology இருக்குமே . இந்த அறிவாளி பசங்க எல்லாம் படிபங்கலே அந்த குரூப் . அதுக்காக நான் அறிவாளியனு நீங்க அறிவாளிதனாமா கேள்வி கேக்கபடாது . சரி விஷியத்துக்கு வருவோம் 1st குரூப்னாலே கம்ப்யூட்டர் அறிவெல்லாம் அவ்வுளவா கிடையாது . அதாவது கம்ப்யூட்டர் சயின்ஸ் படிக்குற ஸ்கூல் பசங்களுக்குத்தான் அதெல்லாம் தெரியும் . அதுவும் அப்போ black &white monitor வேற , MS dos ல தான் ப்ரோக்ராம் எல்லாம் பண்ணுவாங்க அந்த பக்கம் போனாலே ஒண்ணும் புரியாது. கம்ப்யூட்டர்ல சன் டிவி தெரியாதன்னு அப்பாவியா கேட்ட காலம் அது . எப்படியோ ஸ்கூல் முடிஞ்சு இன்ஜினியரிங் join பண்ண போறேன் . இன்ஜினியரிங் ல கண்டிப்பா கம்ப்யூட்டர் படிச்சு சாகனும் அடடா இல்ல இல்ல படிச்சாகணும்ன்னு தெரிஞ்சு போச்சு . அப்போதான் கம்ப்யூட்டர் பத்தி தெரிஞ்சுக்க ஆரம்பிச்சேன் . அப்போதான் இன்டர்நெட் அப்படிங்குற ஒன்னு இந்தியாக்கு அறிமுகம் ஆகுற சமயம் . எனக்கு ஒரே ஆர்வம் இன்டர்நெட் பத்தி தெரிஞ்சுக்க . காலேஜ் join பண்ணினேன் 1st இயர்ல. நான் படிச்சா கோயம்புத்தூர்ல இன்டர்நெட் ப்ரொவ்சிங் சென்டர் எல்லாம் வர ஆரம்பிச்ச சமயம் அது . அட அட அட என்ன ஒரு அழகு போங்க . செமைய இருக்கும் . ஒரு புது அனுபவம் அது . அது வரைக்கும் நமக்கு தெரிஞ்சது எல்லாம் சினிமா தியேட்டர் , பார்க் , கோவில் , பீச் , ஹோட்டல் எல்லாம் தான் . இந்த ப்ரொவ்சிங் சென்டரும் , இண்டர்நெட்டும் ஏதோ ஒரு புது உலகத்துக்கு போற மாதுரி இருந்துச்சு . அப்போ என்னோட ப்ரிண்ட்ஸ் கூட discuss பண்ணதுல கொஞ்ச விஷயம் கிடைச்சது . இன்டர்நெட் ல என்ன பண்ணலாம்னு . ஏதோ ஈமெயில் அனுபலாம்ன்னு சொன்னங்க . சரின்னு நானும் போனேன் இன்டர்நெட் ப்ரொவ்சிங் செண்டர்க்கு . போன cabin cabin ஆ இருக்கு . அங்க ப்ரொவ்சிங் சென்டர் owner நம்ப சிரிச்ச முகத்தோட வரவேர்த்தார் . இன்டர்நெட் பாக்கணும்ன்னு சொன்னேன் . 1hr க்கு Rs 100 அப்படிநாரு . என்னக்கு தூக்கி வாரி போட்டுச்சு அன்னைக்குனு பாத்து என்ன பாக்கெட் ல இருந்தது வெறும் 60 ரூபாய் தான் , ஐயயோ இன்டர்நெட் பாத்து முடிச்சுட்டு பணம் பத்துலேன்னா , ஹோட்டல் ல சாப்பிட்டு காசு குடுக்கலேன்னா மாவட்ட சொல்லுற மாதிரி இங்கயும் எதாவது சிஸ்டம் வச்சு இருப்பங்களோ ன்னு என்னக்கு பயம் வேற . உள்ள வரைக்கும் வந்தாச்சு இன்னிமே திரும்பி போன அது நம்ப பரம்பரைக்கு வேற அவமான போய்டும் . என்ன பண்ண ? சரி அப்போ அரை மணி நேரம் தருவிங்களன்னு கேட்டேன் , மருதா முருகன் புண்ணியத்துல அவரும் தருவோம்ன்னு சொன்னாரு , அப்பாடி trouser தப்புச்சதுடன்னு நானும் உள்ள போய் உக்காந்ததும் தான் என்னக்கு தெரிஞ்சது , அங்க என்ன பண்ணுறதுன்னு என்னக்கு தெரியலன்னு . சரி கூச்ச படமா அவர கூபிட்டு கேட்டேன் இன்டர்நெட் எப்படி பாக்குறதுன்னு அவரு என்னமோ பிறக்கும் போதே கைல லேப்டாப் ப்பும் , laptop with 2mps broadband wireless connection  னோட பொறந்த மாதிரி என்ன ஒரு லுக் விட்டுட்டு இன்டர்நெட்க்கு புதுசான்னு கேட்டாரு , நானும் நாலு cabin குள்ள நடக்குற விஷயம் வெளிய நாலு பேருக்கு தெரியாதுங்கிற தும்பிக்கைல அட ச்சா நம்பிக்கைல ஆமானு உண்மைய ஒத்துகிட்டேன். அவரும் பெரிய மனசு பண்ணி என்ன பண்ணனும்ன்னு சொல்லி குடுத்தாரு . அப்போ எல்லாம் hotmail தான் . அவரும் எது ஏதோ details கேட்டாரு நானும் வெக்கபடாம சொன்னேன் , கடைசில எனக்கு ஈமெயில் id ஒன்னு create பண்ணாத சொல்லி ஒரு ஈமெயில் id யும் password டும் குடுத்தாரு அதுக்குள்ள அரை மணி நேரத்துக்கு மேல ஆகிடுச்சுன்னு சொல்லி ஏதோ பெரிய மனசு பண்ணி 50 ரூபாய் மட்டும் போதும்ன்னு சொல்லிடாரு. password எல்லாம் நமக்கு மட்டுமே தெரிஞ்சு இருக்கணும் கூட தெரியல அப்போ . இதுதான் எனது முதல் முதல் ஈமெயில் உருவான வரலாறு ...... [ இப்போ அந்த ஈமெயில் id நினைவு இல்ல :-( ...... ]
இன்னும் இன்டர்நெட் அனுபவங்கள் தொடரும் ............
அன்புடன்,
ராக்ஸ் ....
For fun chat, blog, forum, videos, games, live FM  kindly visit our website:  www.tamilrockzs.com

4 comments

என்னையும் blog  எழுத வச்சுடிங்களே

எனது முதல் blog . . . .
வணக்கங்களுடன் ராஜேஷ் ,  வலைபூ தளத்துக்கு நான் புதுசு , அதுவும் எழுதுறது இதுதான் முதல் தடவை . நேரம் கிடைக்கும் போதும் , எப்பவாவது நெட் ல மேஞ்சுகிட்டு இருக்கும் போது கண்ணில் பட்ட வலைபூவை படிச்சு இருக்கேன். சில வலைபூ எந்த வித தாக்கத்தையும் ஏற்படுத்தாது , படிச்சமா போனமான்னு இருப்பேன் , சில வலைபூ படிக்கும் போதே எரிச்சல் வரும் அப்படியே அத மூடிட்டு புள்ள குட்டிங்கள படிக்க வைக்கலாமான்னு தோணும் ஆனா அடியனுக்கு இன்னம் கல்யாணமே  ஆகததுனால ( நான் சின்ன பையன்கோ )   வேற தளத்துக்கு போய்டுவேன் . ஆனா சில வலைபூவ  படிக்கும் போதுதான் மனசு என்னவோ பண்ணும் , சந்தோஷ படும் , வாய் விட்டு சிரிச்சு இருக்கேன் , அந்த மாதிரி வலைபூ படிக்கும் போதுதான் என்னாகும் இப்படி எதாவது எழுதனும்னு தோணும் . ஆனா எங்க நேரம் இருக்கு ? நேரம் இருந்தாலும் பொறுமை கிடையாது. தமிழ் ல வேற எழுதணும் அதுவும் கஷ்டம். ஆனா இப்போ ஏதோ என்ன உள்ள கொண்டு வந்து இருக்கு. பாக்கலாம் . எனக்கு தெரிஞ்சத , நான் ரசிச்ச , நான் அனுபவித்த விஷியங்கள உங்களோட பகிர்ந்து கொள்ள வந்து இருக்கேன் . முடிஞ்ச வரை யாரையும் புண் படுத்தமா , நல்ல  நகைச்சுவைகளை , அனுபவங்களை எழுத முயற்சிக்கிறேன் . என்ன்கிட இருந்து பெருசா எதையும் இலக்கியதுவமா எல்லாம் எதிர்பாக்கதிங்க . எதார்த்தத்தை எதிர் பாக்கலாம் . கண்டிப்பா டிசன்ட்டான எழுத்துகளை குடும்பத்தோட படிக்குற மாதிரியா இருக்கும்.
           சரி அதெல்லாம் இருக்கட்டும்,  என்னோட சீனியர்களே , வலைபூ ஜாம்பவான்களே,  இந்த முறை செய்யுறது , பின்னோடாட்டம் போட்டு உங்கபதிவுல நானும் ஆட்டத்துல இருக்கேன்னு அட்டேண்டன்சே போடுறது , வோட்டு போடுறது , அப்புறம் நம்ப பதிவ எப்படி விளம்பர படுத்துறது , என்ன பண்பாடு கலாச்சாரம் ன்னு கொஞ்சம் சொல்லி குடுங்கப்பா .நானும் ரவுடி ஆகணும் இல்ல .
                அதனால சகலமவர்களுக்கும் தெரிவிப்பது என்னவென்றால் , இப்போது  இருந்து இந்த ராக்ஸ் சோட கேம்  ஆரம்பிக்குது, அதனால  எல்லாரும் அலார்ட இருந்துகோங்க ( ஓவரா சவுண்ட் குடுக்குறோமோ? )


அன்புடன்,
ராக்ஸ். . .
For fun chat, blog, forum, videos, games, live FM  kindly visit our community website:  www.tamilrockzs.com

Related Posts Plugin for WordPress, Blogger...

Follow by Email

My Blog List

My Promoters